KEGG   Aspergillus clavatus: ACLA_033390Help
Entry
ACLA_033390       CDS       T01148                                 

Definition
dihydrolipoamide succinyltransferase, putative
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
act  Aspergillus clavatus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACLA_033390
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACLA_033390
  Amino acid metabolism
   00310 Lysine degradation
    ACLA_033390
Enzymes [BR:act01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ACLA_033390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 461 aa AA seqDB search
MASRLPFHRLSALQLRTVPRTAQSSRMLCIGARRSITSNALRKLRPDAVLLQAPIHCSDV
SQYGLTRLGGYQVRTYADTIVKVPQMAESITEGTLKQFSKQVGDYVERDEEIATIETDKI
DVSVNAPESGTIKELLVNEEDTVTVGQDLVKLELGGAPEQKTEAATEKPKEPADVERRPS
PEAHEPKTPETPNAPSPSEEKPTAPKPQPKAAKAETPSETKPSLGNREERRVKMNRMRLR
IAERLKQSQNTAASLTTFNEVDMSSLMEFRKLYKDEVLKKTGVKLGFMSAFSRACVLAMK
DVPAVNASIEGPNGGDTIVYRDYVDISVAVATEKGLVTPVVRNTETMDLIDIEKAIADLG
KKARDNKLTIEDMAGGTFTISNGGVFGSLMGTPIINLPQTAVLGLHAIKDRPAVVNGKVE
VRPMMYLALTYDHRLLDGREAVTFLVKVKEYIEDPRRMLLG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcttctaggttgccctttcatcgtctctcagcgctccagctgaggactgttcctcga
actgcgcagagctctcgtatgctttgtattggtgctcgcagaagcatcacctcgaatgcg
ctcagaaagctccgaccagacgcggtcttgctgcaagctccaatccattgctccgatgtg
tctcaatatggtctcactcgcctaggaggctatcaagtcagaacctatgctgataccata
gtgaaggttcctcaaatggcagaatcaatcaccgagggtaccttgaagcaattctcgaaa
caggttggcgactacgttgagcgggatgaagaaatcgccaccattgagacagacaagatt
gacgtatcggtcaatgctcctgaatccggaactatcaaagagctccttgtgaacgaagaa
gatactgtgacggtcgggcaggacctcgtcaaattggaattgggtggcgccccggaacaa
aagactgaggcggcgaccgaaaaaccaaaggagcccgcagatgttgagaggcgcccgtct
cctgaagctcacgagcccaagaccccggagaccccgaacgccccttcaccttctgaggaa
aaacccactgccccgaagccacagcccaaggccgcaaaagcggagactccttctgagact
aagccgagccttggaaaccgcgaagaacgtagggtcaagatgaacagaatgagattgagg
atcgctgaacgcttgaagcagtctcagaatacagccgcgtctctcaccacgttcaatgaa
gttgacatgtcatctctcatggaattccgaaaactctacaaggatgaggtgctgaaaaag
actggagtcaagcttggattcatgagcgccttctctcgtgcctgcgtgttggctatgaag
gatgttcccgccgtcaatgcgtcgatcgagggccccaacggcggtgacactatcgtttac
cgtgactacgttgatataagcgtggccgtcgctaccgaaaagggacttgtgacccctgtt
gtccgtaatactgagaccatggatttgattgatattgaaaaggctatcgcagaccttggc
aagaaagcgcgtgataacaaattgacaattgaggatatggccggtggcactttcaccatt
agcaatggtggcgttttcggatctttgatgggcactcccattatcaatttaccccagaca
gctgtcctcggacttcatgcaatcaaggatcggccagcagttgtgaacggcaaggtcgaa
gttcgtccgatgatgtaccttgctttgacatacgatcacagacttctggatggacgagag
gcagttacattccttgtcaaggtcaaggaatatattgaagatcctcgccgcatgttgctc
ggctag

DBGET integrated database retrieval system