KEGG   Aspergillus clavatus: ACLA_033410Help
Entry
ACLA_033410       CDS       T01148                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     ACLA_033410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 242 aa AA seqDB search
MAWYCSGTTNAELVENLYNEGLIKNDRVKKAMMGVDRAHYAPSRPYSDSPQPIGHGATIS
APHMHGHACEYLVDFLKPGSRVLDIGSGSGYLTHVLANLVTDLSPVDGTGGQVIGVDHIP
ELVDLARANMSKSEQGRKLLDSAKVKFIIADGRLGWREGAPYDAIHVGAAADRLHPLLIE
QLRAPGRLFIPVDAENDDGPVSSLAFGGGQFIWVVDKKEDGSVQKEKVFQVSYVPLTDAP
KR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcctggtactgttctggcacgaccaacgcggagttggtcgagaacctgtacaacgaa
ggactgatcaaaaatgatcgagtgaaaaaagccatgatgggagttgatcgcgcccattac
gcaccctcacgaccgtactccgactcgccccaaccaatcggccatggtgcgacgatatca
gctccacacatgcacggccatgcctgtgagtacttggtcgactttctcaaaccgggatca
cgagtgttagatatcggctcgggttccgggtacttgacacacgttctcgccaatctcgtg
acagacctgtcgccggtcgatggcaccggcggccaggtcattggagttgatcatatacca
gaactggttgacctagctcgagcaaatatgagcaagtcagagcaaggccgaaaactcctg
gactctgcaaaagtaaaatttatcatcgccgacggtcgactcgggtggagagagggggcc
ccgtatgatgcgatccatgtgggtgcagcggcagataggctgcacccgctgctaattgaa
cagctacgtgctccaggacggttgttcatacccgtggatgcggagaacgatgacggccca
gtgagtagtcttgcgttcggtggcgggcaattcatctgggtggtcgacaagaaagaagat
ggctctgttcaaaaagaaaaggtcttccaagtgagctatgtgccattgacggatgcaccg
aagcgataa

DBGET integrated database retrieval system