KEGG   Aspergillus clavatus: ACLA_033520Help
Entry
ACLA_033520       CDS       T01148                                 

Definition
ubiquitin carboxyl-terminal hydrolase, family 1 protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ACLA_033520
Peptidases [BR:act01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   ACLA_033520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 341 aa AA seqDB search
MTLTSKKQAARKGYGLRIKSTASNACASVALLNIVNNIEGLDLGENLQCFKNFTMPFTPA
LRGDAISNFEFVKRIHNSFARKMDMLNSDLQLKTEATSKRSRTGKTRRDDYESDAGFHFI
AFVPALGKIWKFDGLERQPQALGAYGGTGYSIRAHHDAGEYTPEIDWLTLVRPNILTRMA
EYEEDQIEFSILSVAKDPLVEFEERLAANVKCLELVNQRLASSKAEEAKKIDSVPSSAAA
LLENTIIGPDPSFNLTRDRIDGAIIPPDVERLYGQASLEEMRRYQYQLGSEQQELRASMR
EEQQSHRSDDDYAVGRRFDYGPAVRAWVRLLARKKLIESLR
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgacaagcaagaagcaagctgcccggaagggctatggtttgcgaatcaagtca
actgctagtaacgcttgcgcaagcgtggcactcctgaacatcgtcaacaatatagaggga
ttagatctcggtgagaatctacaatgtttcaagaattttacgatgccattcacgccagca
ctgaggggtgatgcgatcagtaattttgaatttgtcaaacgcatacataattcctttgcg
aggaagatggacatgcttaactcggacctgcaacttaaaacggaggcaacatctaagcgt
tctcggacaggcaaaaccaggcgtgatgattatgaatcggatgcaggatttcatttcatt
gcatttgtccccgcattggggaagatctggaagtttgacggcttggaacgacagcctcag
gctctcggtgcgtatggtggaaccggctattcaatacgtgctcatcatgatgcaggagaa
tatacgcccgagatagactggctaacattggtacgacccaatattctcaccagaatggca
gaatatgaagaagatcaaatcgaattctcaattctcagtgtggccaaggatcctttggta
gaatttgaggagagattggcagccaacgtcaaatgcttggaattggtcaaccagcgcctg
gcttcctcaaaggcagaggaagccaagaaaatcgactctgtaccctcatccgctgctgct
ttgcttgagaatacaataatcggacccgatccctcctttaatctgaccagagaccggatc
gatggcgcgattatcccgcccgatgtggaaagactctatggccaagcttcgctagaggaa
atgaggcgttatcaataccagctcggtagtgagcagcaggagcttcgagcttcgatgcgg
gaagaacagcaatcccaccgatcagatgacgactacgcggtcgggcggcggttcgactac
ggaccagcggtaagagcctgggtacgccttttggcgcgcaagaagctcatcgaaagcctt
cgatga

DBGET integrated database retrieval system