KEGG   Aspergillus clavatus: ACLA_033870Help
Entry
ACLA_033870       CDS       T01148                                 

Definition
MAP kinase kinase Ste7
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
act  Aspergillus clavatus
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:act00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    ACLA_033870
Enzymes [BR:act01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     ACLA_033870
Protein kinases [BR:act01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   ACLA_033870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 535 aa AA seqDB search
MADQFKARTLKRKNVKGLALNSAPKPASKPADGDAQVSGAVGNTDNNRTDTLEIGLEFRL
DLRSEDLVTLKELGAGNGGTVSKVMHASTKVVMARKIIRVDAKENVRKQILRELQVGHDC
NSPHIVTFYGAFQNEARDIVLCMEYMDCGSLDRISKDFGPVRVDVLGKITESILAGLVYL
YEAHRIMHRDIKPSNILVNSRGNIKLCDFGVATETVNSIADTFVGTSTYMAPERIQGGAY
TVRSDVWSVGLTVMELAVGRFPFDASDASAGDRASAGPMGILDLLQQIVHEPAPKLPKSD
AFPPILHEFVAKCLLKKPEERPTPRELYDKDAFLQAAKRTPVDLQEWAISMMERHNRKSY
LAPPAPKSLKEETGHAAPPPKPSASKPARTPGYTPTSGEIPLNIANDTSAAHYRHYNGSS
NPSPHLARSTRSPPPPISLEHLSLETKEDEYRSGRRPSRNYPGDPVSAIEPPTRQHISSR
SASSHNKSRMPLQTATLPIRAVPPPSGPPPPAPVSAGGSWRRQMNQSRGDMTGAA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcagttcaaagctcgcacgttgaaacgtaagaacgtcaagggccttgccttg
aattccgcgcccaagcctgcgtctaaacccgcggacggtgatgctcaagtttccggcgct
gtcggcaataccgacaacaaccgcacagatactttggagattggactggaattccgactg
gatcttcgtagcgaagacttggtcactttgaaggaactgggagccggaaatggaggaacg
gtttccaaagtgatgcacgcatctacaaaggtcgtgatggctaggaagataattcgcgtg
gatgccaaggagaatgtgagaaagcagatcctgcgtgagctgcaggttggacatgactgc
aactcccctcatatcgtgaccttctatggagcgttccagaacgaagcgagggacattgtt
ctgtgtatggaatacatggactgcggttccctcgatcgcatctccaaagactttggtcct
gtccgggttgatgtgttgggcaagatcaccgagtcgatcctagcgggcttggtgtatctc
tacgaggcgcaccggatcatgcatcgtgacatcaagccttccaacatcctggtgaactcg
cgaggtaatatcaaactttgcgattttggtgtcgctaccgagacagtcaactcgatcgcc
gacactttcgtcggaacttctacgtacatggcaccggagcgaatccaaggtggcgcctac
acagtgcgatcggacgtctggagtgtcggtctgaccgtgatggaattggctgtgggccgt
tttccctttgatgcatctgatgcgtctgcgggagatcgcgccagtgccggcccaatgggc
attcttgacttgctgcagcaaatcgtgcatgagccggctcccaagctgccgaagagtgac
gctttcccgcccattctacacgagtttgttgccaagtgtttactcaagaaacccgaggag
cgaccgactcctcgagagctatacgacaaagatgctttcctgcaggccgccaaacgtaca
ccggttgatctacaagaatgggccatcagcatgatggagcggcacaaccgcaaatcctat
ctggctccgccagctcccaaatcactgaaggaggagaccgggcacgccgccccgcctccc
aaacccagtgcgagcaagcctgctcggacgccaggctacactcctacgtccggggagatt
cccctcaacattgccaacgacacgtctgctgcccactaccgtcattacaatgggtcctca
aacccgtcgccgcacctggcccggtcgacgcgctcgcctcctccaccgatatcgctggaa
cacttgtcgctcgagaccaaggaggatgaataccgctccggccgccgtccgtcacgcaat
tatccgggagacccagtctctgccattgagccgccgacccgacagcacatcagttctcgc
tcggccagctcgcacaacaagtcgagaatgccgctccaaacggcgacgcttcccattcgt
gccgtgcctcccccgagcgggccacctccaccagcgccagtatcggcgggaggctcctgg
cgtcgccaaatgaaccagtcccgcggtgatatgacgggggctgcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system