KEGG   Aspergillus clavatus: ACLA_034430Help
Entry
ACLA_034430       CDS       T01148                                 

Definition
histone-lysine N-methyltransferase (Ash1), putative
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
act  Aspergillus clavatus
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    ACLA_034430
Enzymes [BR:act01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     ACLA_034430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 847 aa AA seqDB search
METRTKSSVASLAIPATFSDLQNHAHEHIDDAMSMDIPEQLLTPENSRSETSSNNENAST
EEKPILRRTSSRVTRASLRKSAQFETTLEKENGISTSSPGQEDRTLAPGSLANNLTKLKR
SHSSHLRHSIAVMETSLWNETTLIQDRLEIEDHPMAPDTPVSNSSQEPQPNELSTALQHR
NLRKRVERALTQDDSPDRNKSTIKAQPEDLPTPRRSTRLSLLEKASDWVEKASSILGKRS
IDKMKEGKDSDRRSSLRPRNVAPKEEIASLATTEPPAAKKRRVSESDLPLNTKDPEDPIA
GTENAPGKVEPKVKSKRWLTHGLYTGQEFTTSRPSQNRNKSAKRKSLGAPLQRRFLPMPM
FAGDRLLQLGRDFQLPFDIYSPLPAGQPKPDEWRKTNKNVFVGEAGSIWRANKHMELSKC
MCIEETGCDENCQNRYMFYECDEGNCGLGPDCGNRSFEELKQRTKVGGKYNIGVEVIKTE
DRGYGVRSNRTFEPNQVIVEYTGEIITQVECEKRMRTLYKNNECYYLMYFDQNMIIDATR
GSIARFVNHSCEPNCRMEKWTVAGKPRMALFAGDRGIMTGEELTYDYNFDPYSQKNVQQC
RCGAPNCRGILGPRPREKDQRSKERESRILNQKKSSITKKSTTTRKVTGTKRKSGTALDK
SSSHLNKKRRLLAPNSIAKGVRKAVSKARASVSRSKTSAKRTTVTVQSKESKKTVTRGRE
PAPKAQAKAKESKPRSTVKLPKVKSAKTKVKAAILPKTSSKATTKSPSKPRASQPTSSTL
KRPSEKAKEKILRAAKGVNARKQTTKEKKVDTKSPRKSPKSNNAKKTPQAKAPAKRTKSL
AAKLQPK
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggaaactcgaactaaatcctccgtcgcgtccctcgcgatacccgcaaccttctcggac
ctgcagaaccatgcccacgagcacatcgacgatgccatgagcatggatatcccggaacaa
ctccttacacctgaaaacagtcggtctgaaacgtccagcaacaacgaaaacgcgtctact
gaagagaagccgatcctgcggcgaacatcctcacgtgtaacacgcgcctccttacggaag
tcggcacaatttgagacaacgttggagaaagaaaatgggatttccacgtcttcgccaggc
caggaggatcgtacgctggccccggggagcctggcaaacaatctcacgaagctgaagcgg
tctcattcctcccatctacggcacagcatagcagtcatggaaacatccctgtggaacgag
acaacgctcatacaggataggcttgagattgaagaccacccaatggctccggacacaccg
gtctccaactcatcccaagagcctcagccaaatgaacttagcacggctctacagcatcgc
aacttgaggaagcgtgtggaacgggcattgacccaggatgatagtcccgaccgaaataaa
tctacaatcaaagctcaacccgaggatcttccaacacctcggcgctcaacccgtctgagt
ctattggagaaggcctccgactgggttgaaaaagcgagtagcattcttgggaaacgatcc
attgataagatgaaagaagggaaagacagtgatcgccgatccagtctgcgacctcggaat
gttgcgcctaaggaggaaattgcctctcttgcgactactgaacctccagctgcaaagaaa
cggcgtgtctctgaaagcgatctgcccttgaacacaaaggaccctgaagatcctatagca
ggaaccgaaaatgctcctgggaaagtcgagccgaaagtgaaatcaaagcgctggttgact
catgggctgtatacaggccaagagtttactacttctagacccagtcaaaataggaacaag
agcgcaaagagaaaatccctaggcgcgccattgcagcgcaggtttctcccaatgccaatg
ttcgcaggtgaccggcttttacagctaggaagagatttccagttgcctttcgacatctac
tctcctcttccagcaggtcaacctaagcctgatgagtggagaaaaaccaacaaaaatgtc
tttgttggggaggcgggtagtatatggagagccaacaagcacatggagttatctaagtgc
atgtgcatagaagagaccggctgcgatgagaactgccaaaaccggtacatgttttatgaa
tgcgacgaaggcaattgcggactaggtcctgattgtggtaatcggagctttgaggaactc
aagcaaagaactaaggtgggaggcaagtataatatcggtgtggaggtcatcaagacagaa
gatcgcggatacggcgttcgcagcaaccgtacctttgagccaaatcaggtcatcgttgaa
tatacaggtgaaatcatcactcaggtggaatgtgagaagaggatgaggaccctctataag
aacaatgagtgctattaccttatgtactttgaccagaacatgataatcgacgctacccga
ggatccatcgcgcgcttcgtgaatcattcttgtgaaccaaactgtcgaatggagaaatgg
accgttgcaggcaaaccacgcatggctctttttgccggtgaccgtgggatcatgaccggt
gaagaattaacttacgattataactttgatccatattcacagaagaatgttcaacagtgt
cgatgtggtgctccgaactgtcgtggaattttgggaccacgacctagagaaaaagaccaa
cgctcgaaagaaagagaatctaggatcctaaatcagaagaagagctcaatcacaaagaag
tcaacgacaaccagaaaggttacaggcacgaagcgcaagagcgggaccgcgcttgacaaa
tcttcatcacatctgaacaaaaaacggaggctcctggcaccaaattctatcgcaaaaggc
gtgagaaaagctgtgtccaaggctcgcgcatcggtttccaggtcaaaaacttccgcgaaa
aggacaacggtaacagtacaatccaaagaatctaagaaaacagtcacaagagggagagag
ccggcacccaaggcgcaggcgaaggccaaagagtcgaagccccggtctactgtcaaacta
ccgaaagtcaagtctgccaaaacaaaggtgaaagcggctattcttcctaaaacgtcttcc
aaagctacaaccaaatcaccgtcgaaaccacgggcttcccagccgacttcatctaccttg
aaacgcccgtccgaaaaggctaaggagaagatcctcagggcagccaaaggtgtaaatgct
cggaaacagacaacaaaggagaagaaggtcgatacgaaatcacctcgcaagtctcccaag
agcaataatgccaaaaagacccctcaggccaaggctccagctaaacgcacgaagagtctg
gccgctaaactgcaaccaaaatga

DBGET integrated database retrieval system