KEGG   Aspergillus clavatus: ACLA_036710Help
Entry
ACLA_036710       CDS       T01148                                 

Definition
endosome-associated ubiquitin isopeptidase (AmsH), putative
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
act  Aspergillus clavatus
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:act00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    ACLA_036710
Enzymes [BR:act01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     ACLA_036710
Peptidases [BR:act01002]
 Metallo Peptidases
  Family M67
   ACLA_036710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 546 aa AA seqDB search
MTSHTAQNMGASPQSVEKITRIAQDYEYNPLIPLRNWLRTASTLIREARIYEREGHDEQT
YLLLFRHAQLVLVNLAKHPEAKDEKYRKALMEAEKEVQINLGKLEALKPRINKRYERFVQ
LMRERQSRTPSHETSSGSLNQTQPYDPALAGVVEPLEAGKNRDLAVQLARTEISRRATVR
KALRQAGVSPGEDQSRRTVGDWGNRDDRLDKNGPDTDNDLRRRIQDVRLNIDQQAHTGLR
QPQQNKTVVRPPTSISSTSTYKYPTVPRQRPLESLPSTVTKSSREKLGLRSEPPLLPPKE
LPGSNRPAPAAGLLPPPLPGKISPAPAPAVPEKASTTADSGNSGSGLDPSSFTFKPSAYL
ENGTPLRTMWLPPELRTHFLAVAASNTRRNLETCGILCGTLISNALFVSRLLIPEQTATS
DTCETVNETAIFDYCDSEDLMVLGWIHTHPTQTCFMSSRDLHTHCGYQVMLPESIAIVCA
PSKSPDWGVFRLTDPPGLKTVLNCTQTGLFHPHAEANIYTDALRPGHVFEAKGLEFETVD
LRPNGS
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacataccgctcagaacatgggggcgtcaccacagagcgtggagaagatcact
cgaattgcccaagactacgagtacaaccctctaataccgctgcgaaactggttaagaact
gcctctacgttgattagagaggcccggatctacgaacgagaaggacatgacgaacaaaca
tatctactcttgtttcgacacgcacagctggtgctcgtgaacctagcaaaacaccccgaa
gccaaagatgagaagtacagaaaggctctgatggaagccgagaaagaagttcagatcaat
ctgggaaaacttgaggcgctgaaaccccggatcaacaaacgctatgagcgttttgttcag
ttgatgcgtgaacgccaaagtcgaaccccatcccacgaaacgagcagtggctcattgaac
cagacacaaccgtacgatcccgcgctggcgggagttgttgaacccttagaggcaggaaag
aatagagatctggccgtgcagctggcccgaacagagatcagtcgaagagcgactgtgagg
aaagctttgcgccaggcgggtgtatcacccggagaagatcagagtcgccgcacggtgggt
gattggggcaacagggacgatcgcttggacaaaaacgggcctgatacggacaatgacttg
cgccgccggattcaggacgtcagactcaatatcgaccagcaagcccatacgggtcttcgc
cagccgcaacagaacaagaccgtcgtacgtccaccgacttctatctcgtctacctctacg
tacaagtatcccacggtaccccgacaaaggcccttggagtccctcccatccacggtgaca
aaatcgtctcgagagaaattaggtctccgctcagaacctcctttactgcctccaaaagag
ttacctggttcaaaccgtccggctcccgccgctgggctgttgccgccaccactgcctggc
aaaatatctccagcaccagctccagctgtcccagaaaaagcatcaacaacagcggacagt
gggaactcgggctcaggattggacccttccagtttcaccttcaaaccttccgcatatctc
gagaatggaacgccattgcgcaccatgtggctgccaccggaactgcggacacacttctta
gctgtggccgcatctaatacgcgccgcaatctagaaacatgcggcatcctctgtggtact
ttaatctccaacgcactctttgtgtcccgattgcttatcccggaacaaacggcgacgtcc
gatacctgtgaaactgtaaatgaaaccgcgatcttcgactattgcgattcagaagacctg
atggtgctgggctggatccacacacatcccacgcagacatgtttcatgagttcgagggac
cttcacactcactgtggatatcaagtgatgctccccgagagcattgcaatcgtctgcgcg
ccaagcaaatctccagattggggcgtgttccgactcaccgatcctccagggctgaagacg
gtcctcaactgcacacagacgggcttgtttcatcctcatgccgaggccaatatctacact
gatgcgctacggcctggacatgtcttcgaagctaaggggctcgaatttgagaccgtagat
ctacgtccgaacggatcctag

DBGET integrated database retrieval system