KEGG   Aspergillus clavatus: ACLA_037140Help
Entry
ACLA_037140       CDS       T01148                                 

Definition
fatty acid hydroxylase, putative
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
act  Aspergillus clavatus
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    ACLA_037140
  Amino acid metabolism
   00380 Tryptophan metabolism
    ACLA_037140
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     ACLA_037140
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     ACLA_037140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1122 aa AA seqDB search
MTESKTIPIPGPKGVPLLGNIYDIEQEVPLRSINMMADHYGEIYRLTTFGRSRVFLNTHE
LVNEACDEERFSKVVTAGLNEIRNGIHDGLFTAHFPGEENWAIAHRVLVPAFGPLSIRGM
YDDMYDIATQLVMKWARQGPHVPIMVTDDFTRLTLDTIALCAMGTRFNSFYHEEMHPFVE
AMVGLLQGSGDRARRPALLNNLPTSENAKYWSDIEFLRKLAQELVDNRRQNPEDKKDLLN
SLILGRDPKSGQGLSDSSIIDNMITFLIAGHETTSGLLSFLFYYLLKNPRAYQKAQEEVD
AVIGRRKITVEDLSKLPYINAVMRETLRLRSTAPLIALHAHPEKNKEDPVTLGNGKYVLN
KDEAIVIVLDKLHRDPKVYGPDAEEFRPERMLDEEFDKLPKNAWKPFGNGMRACIGRPFA
WQEALLVVAILLQNFNFQMDDPSYDLHIKQTLTIKPKDFHMRAALRHGLDATQLGIMLSG
SVDSVPPESAGAASRSRKPQAAAPPSGQLKPMHIFFGSNTGTCETFARRLADDAVGYGFA
AEVQSLDSAKENIPKEDPVVFITASYEGQPPDNAAHFFEWLSGLKGKELEGINYAVFGCG
HHDWHATFHRIPKAVNELVGERGGNRLCDLGLADAAHSDMFTDFDSWGESAFWPAITSKF
GGGKSETGTKATSNLQVEISSGMRASTLGLQLQEGFVIENQLLSQPGVPAKRMVKFKLPS
DMTYQCGDYLAVLPVNPSSVVRRAIRRFDLPWDAMLTIRKSSQASKGSTSIPLDTPVSAF
DLLSTYVELSQPASKRDLNVLADAAAADADVQAELRYLASSPSRFTEEIVKKRLSPLDIL
IRYPSIKLPVGDFLAMLPPMRVRQYSISSSPLADPSECCITFSVLNAPSLAAASLPPQEQ
EEAEQYLGVASTYLSELKPGDRAHISVRPSHSGFKPPMDLKTPMIMACAGSGLAPFRGFV
MDRAEKIRGRHSSIGSDKEIPETAKPAKAILYVGCRTKGKDDIHAAEFAEWAQLGAVEVR
WAYSRPEDGSKGRHVQDLMLEDRAELVDLFDQGARIYVCGSTGVGNGVRQACKEMYLERR
RQVRQEKRERGEDVAEDDEDAAAEQFLDNLKTKERYATDVFT
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatcgaaaaccatccccattccaggccccaagggggttcccctcttggggaat
atctatgatatcgaacaggaagtccctctgaggagcatcaacatgatggcagatcattat
ggcgaaatctatcggttgaccacatttggccgctccagagtgtttctgaacacccatgaa
ctcgtcaacgaggcttgtgacgaagagagattcagcaaggtcgttacagcgggcttgaac
gagatccggaatgggatccacgatggcctgtttaccgctcactttcctggcgaggaaaac
tgggccattgcccaccgcgtgcttgtcccagcctttggaccgttgtctattcggggaatg
tatgatgatatgtacgatattgcgacgcagcttgtcatgaagtgggcgcgccaggggccc
catgtcccgattatggtcaccgatgacttcacccggttgactctagacacaatcgcactt
tgtgctatggggacacgcttcaactccttctaccacgaagaaatgcacccgttcgtcgag
gcaatggttggtttgctgcaagggtccggtgacagggcccgccggccggccctccttaac
aacctgcccacaagtgagaatgccaagtactggagcgatatcgaattcttgcggaaactg
gcccaagaattggttgacaatcggagacagaacccggaggataagaaggatctgctaaac
tcattgatcctgggtcgcgatcccaaatccggtcaaggtctcagtgatagttcgatcatc
gacaacatgatcacctttttgattgcgggccacgaaacaacctctggactgctctctttc
ctcttctactacctgctgaagaacccccgcgcataccagaaagcacaggaagaggtggac
gctgtcattgggcggcggaagattacggtcgaagacctatcgaaactgccatacatcaac
gctgtgatgcgggaaacgctgcggctaaggtccacggctcccttgattgctcttcatgcg
cacccagagaagaacaaggaagacccagtcaccctgggaaatggcaagtacgtgttgaat
aaggatgaggccatcgtgatcgtgctcgataagttgcaccgggaccctaaggtctatggc
cctgatgcggaggaattcagaccggagcgcatgcttgacgaggaattcgacaagctcccc
aagaacgcgtggaagccgtttggtaacggtatgcgcgcctgtattggccgcccatttgcc
tggcaggaagcgttgcttgtggtagcaatcctgctgcaaaacttcaatttccagatggat
gatcccagctacgacctccatatcaagcaaacgctcacaattaagccgaaggatttccac
atgagggccgcactgcgccatggcctcgatgcgacccagctcggtatcatgttgagtggt
agtgttgatagcgtgccacctgagagcgccggagcggcgagccgctcccgcaaaccgcag
gctgctgctcctccttctggtcagctgaaaccaatgcatattttctttggcagcaatacg
ggaacatgtgagacgtttgccagaagattggccgacgatgctgtgggatatgggtttgct
gctgaagtccagtcactggattcggccaaggagaatatccccaaggaggatccagtggtg
ttcatcacggcatcttacgagggccagccaccagacaatgctgctcacttctttgagtgg
ctcagcggcctgaaggggaaggagctggagggaatcaactacgctgtttttggctgtggt
catcatgactggcacgcaaccttccaccgcattcccaaggctgtcaacgaactcgttggc
gagcggggtggaaaccgtttgtgcgatctggggctggctgatgctgcccattcggacatg
ttcaccgactttgacagctggggcgagtccgcattctggcctgcaatcacatcaaaattc
ggagggggaaaatcagagacaggcactaaggcgacgtccaatctacaggtggagatcagc
tcaggcatgagagcatcgaccttgggtcttcagctgcaggaagggttcgtaattgagaac
cagctgctctcccagcctggcgtgccggccaagagaatggtcaagttcaaactcccgtcg
gacatgacctaccagtgcggcgattaccttgcggtgctcccagtcaacccgagcagtgtc
gttcgccgtgccatccggcgctttgatctcccctgggacgccatgctgacgatccgtaaa
tcgtcgcaggcttccaagggatccacctccattccgctggacacacctgtgtccgctttt
gatctcctgtccacttatgttgagctctcgcagcctgcatccaagcgagacttgaatgtg
ctggccgatgcagccgcagcggatgccgatgtgcaagccgaacttcgctatcttgcgtcc
agccccagtcgattcaccgaggagattgtcaagaagcggttgagcccgttggatatcttg
atccgctatccgtcaatcaagcttcctgtcggcgacttcctggcgatgctcccgcccatg
cgcgtgcgccagtactccatctcctcctctcccctggcagatccctctgaatgctgcatt
acattttccgtgctcaatgctccgtctctggcggcggcatcgttacctccacaggaacag
gaggaagccgaacagtacttgggggttgcgtccacgtacctgtcggagctgaagcccggc
gaccgcgctcatatcagcgtccggccatcgcactcgggcttcaagccgcccatggacttg
aagacgccgatgatcatggcgtgtgcaggtagtggactcgcgccattccgtgggttcgtc
atggaccgcgccgaaaagattcggggccggcacagctcgattggctcggataaagagatt
cctgagacggcgaagccagccaaagctatcctgtatgttggctgccgtacaaagggcaag
gatgacatccatgccgccgagttcgccgaatgggcgcagctgggagccgtggaggtgcgg
tgggcatatagtcggcctgaggatggctccaagggccgtcacgtccaggacttgatgctg
gaggatcgtgcggagctggttgatttgttcgaccagggtgctcggatttatgtttgtggt
agcacaggggtcggcaacggagtgcggcaggcgtgcaaggagatgtatctcgagcgacga
cgccaggtgcgtcaagagaaacgggaacggggcgaggatgttgccgaggacgatgaggat
gcggcggccgagcagttcttggataatctgaagacgaaggagagatatgcgacggacgta
tttacttag

DBGET integrated database retrieval system