KEGG   Aspergillus clavatus: ACLA_040140Help
Entry
ACLA_040140       CDS       T01148                                 

Definition
glutathione peroxidase Hyr1, putative
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
act  Aspergillus clavatus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:act00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:act00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 185 aa AA seqDB search
MASATTFYDFKPVDKKGEPFDFNSLKGKVVLVVNTASKCGFTPQFKGLENLYQSIKAKHP
EDFTILGFPCNQFGSQDPGSNDEIQSFCQVNYGVTFPVLGKLDVNGDNAAPVFTWLKEKM
PGLMGLKRVKWNFEKFLVSADGKVVGRWASITKPESLEETILKEIEKAKKDGTAASIQKG
GEATE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgcgacaacattctacgacttcaagcctgtcgataaaaagggcgagcccttc
gatttcaactccctcaaaggcaaagtcgtcctcgtcgtcaacaccgcctccaagtgcggc
ttcaccccacagttcaaaggcctcgagaacctctaccagtccatcaaagccaagcacccc
gaagacttcaccatcctgggcttcccctgcaaccagttcggcagccaggatcccggctcc
aacgacgagatccagtccttctgccaggttaactacggcgtcacgttccccgtgctgggc
aagctggacgtcaacggtgataacgcggcgcctgtgttcacatggttgaaggagaagatg
cctgggctgatgggtctgaagcgcgtcaagtggaactttgagaagttcttggtctcggct
gatggtaaggtcgttggccgctgggctagcattaccaagcctgagtcgctggaggagacg
attctgaaggagattgagaaggcgaagaaggatggaacggcggcttccattcaaaaggga
ggagaggctaccgagtag

DBGET integrated database retrieval system