KEGG   Aspergillus clavatus: ACLA_040140Help
Entry
ACLA_040140       CDS       T01148                                 

Definition
(RefSeq) glutathione peroxidase Hyr1, putative
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
act  Aspergillus clavatus
Pathway
act00480  Glutathione metabolism
act00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ACLA_040140
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ACLA_040140
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ACLA_040140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx SCO1-SenC AhpC-TSA Ral
Motif
Other DBs
NCBI-GeneID: 4703488
NCBI-ProteinID: XP_001271224
UniProt: A1CKX4
AA seq 185 aa AA seqDB search
MASATTFYDFKPVDKKGEPFDFNSLKGKVVLVVNTASKCGFTPQFKGLENLYQSIKAKHP
EDFTILGFPCNQFGSQDPGSNDEIQSFCQVNYGVTFPVLGKLDVNGDNAAPVFTWLKEKM
PGLMGLKRVKWNFEKFLVSADGKVVGRWASITKPESLEETILKEIEKAKKDGTAASIQKG
GEATE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgcgacaacattctacgacttcaagcctgtcgataaaaagggcgagcccttc
gatttcaactccctcaaaggcaaagtcgtcctcgtcgtcaacaccgcctccaagtgcggc
ttcaccccacagttcaaaggcctcgagaacctctaccagtccatcaaagccaagcacccc
gaagacttcaccatcctgggcttcccctgcaaccagttcggcagccaggatcccggctcc
aacgacgagatccagtccttctgccaggttaactacggcgtcacgttccccgtgctgggc
aagctggacgtcaacggtgataacgcggcgcctgtgttcacatggttgaaggagaagatg
cctgggctgatgggtctgaagcgcgtcaagtggaactttgagaagttcttggtctcggct
gatggtaaggtcgttggccgctgggctagcattaccaagcctgagtcgctggaggagacg
attctgaaggagattgagaaggcgaagaaggatggaacggcggcttccattcaaaaggga
ggagaggctaccgagtag

DBGET integrated database retrieval system