KEGG   Aspergillus clavatus: ACLA_040950Help
Entry
ACLA_040950       CDS       T01148                                 

Definition
aldose 1-epimerase, putative
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
act  Aspergillus clavatus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACLA_040950
   00052 Galactose metabolism
    ACLA_040950
Enzymes [BR:act01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     ACLA_040950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 412 aa AA seqDB search
MHVKHYLSAVLYGLPVLAQNSQSSHASSASASPADPFKVYTISAENITAKFIPYGARLIS
LLVPDRDGKDQDVVIGYDDPKEYLNDTETVHTFFGAVVGRYANRIKNGTFTIGSSEYHVP
KNENHGVDTLHGGNVGYDQQNWTVTAHSKSAVTFTLLDQGLEKFPGDVITHATYSVDTTV
TPENPQGLPQLTTKLVSLALTEATPIMLSNHIYWNLNAFKAPNVLNDTFLQLPLSNRIIA
TDSILIPNGTILGVDSAFNGAADFTTGKFIGRDLEDSHGMCGLGCTGYDTCFLVDRPPQY
AAPNSLVPIVRMNSSATGISMEVSANMPALQIYTCDNAQMDYVAIKPSQEKRNKEEGKEG
AKNVMQYGCVVIEPEGWVDGINHPEWGQLSEQIFSPADGPAINWATYKFGTV
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtcaagcattatctctctgccgtcctgtatgggttgccagtcctagcccagaac
tcacaatcatcgcatgcctcgtcagccagcgcttctcctgccgaccccttcaaggtctat
accatcagcgcagagaacatcacggctaaattcattccatacggagcacgcttgatctct
ctgctcgttcctgaccgcgacggcaaagatcaggatgtcgtcattggctatgatgatcca
aaggaatatctcaacgacactgaaacggtgcacaccttcttcggtgccgttgttggccgg
tatgccaatcggatcaagaacggcacgttcaccatcggttcatccgaatatcatgtgccg
aaaaacgagaatcacggagtcgacacccttcatggtggcaatgtgggctatgatcaacag
aactggactgtcacggcgcactccaagtcagctgtgacgttcactctgctcgatcagggc
ctggagaaattccctggggacgtcattacccacgctacctacagcgtcgacacgaccgtc
acccccgagaacccgcaaggtctcccccagctgaccaccaaactggtctccctggccctc
acggaggcgacccccatcatgctctccaaccacatttattggaacctgaacgccttcaag
gcccccaacgtcctcaatgacaccttcctgcaactcccgctatccaaccgcatcatcgcc
acagacagcattctgatccccaacggcaccatcctcggcgtcgacagcgccttcaacggc
gctgcagactttaccaccggcaaattcatcggccgcgacctcgaggatagccacggcatg
tgcggcctcggctgcacaggctatgacacctgcttcctcgtggaccggccccctcaatac
gccgccccgaactcgctcgtccccatcgtacgcatgaactctagcgcaacgggcatcagc
atggaagtctcggccaacatgcccgcgctgcagatctatacctgcgacaacgcccagatg
gactacgtcgccatcaagccgtcgcaggagaaacgcaacaaggaagagggcaaggagggc
gcgaagaacgtcatgcagtatggttgcgtggtcattgagcccgagggctgggtcgatggt
atcaaccatcctgaatggggacagctgtcggagcagatcttctcgcctgctgatgggcct
gcgatcaactgggccacttacaagttcggcactgtctaa

DBGET integrated database retrieval system