KEGG   Aspergillus clavatus: ACLA_041310Help
Entry
ACLA_041310       CDS       T01148                                 

Definition
palmitoyl-protein thioesterase precursor
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
act  Aspergillus clavatus
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:act01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:act00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 323 aa AA seqDB search
MYLQSHLLLPLLSLPLISSASPLRTHGTELTPLPLIIWHGLGDDFQRDGMKEVAALADQA
NPGTYIHLIHVGDTAAADRQASFLGNVTEQIDLVCAQLAADPILSTAPAVNALGFSQGGQ
FLRGYVERCNAPPVHNLVTFGSQHNGIAEFQACGATDWVCRGAEALLRAGRWSAFVQARL
VPAQYFRDPAELDAYLANSNFLADINNERPLKNTAYRANLARLNRFAMYMFEDDTMVNPK
ESAWFAEVNATTGAVTPLRERSLYKEDWLGLKALDEQGKLDFRTAPGGHMQLSEKLLSKV
FEEYFGPVEVDVPMSVLTKQLGH
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtaccttcaaagtcacctcctcctccctctcctctccctccccctcatctcctccgca
tctcctctccgcacccatggaaccgaactcacccccctccccctgatcatctggcacggc
ctaggcgatgacttccaacgcgacggcatgaaggaggtcgccgcgctcgccgaccaagcc
aacccaggcacctacatccacctcatccacgtcggcgacaccgccgccgccgaccgccag
gcctccttcctcggcaacgtcactgagcagatcgacctcgtctgcgcccagctcgccgcg
gacccgatcctcagcaccgcacccgccgtcaacgccctcggcttctcgcagggcggccag
ttcctgcgcggctacgtcgagcgctgcaacgcgcccccggtccacaacctcgtcaccttc
ggcagccagcacaacggcatcgccgagttccaggcctgcggcgccaccgactgggtgtgc
cgcggtgccgaggccctgctgcgcgccggccgctggtccgccttcgtgcaggcccgcctc
gtccccgcccagtacttccgcgaccccgccgagctggacgcctacctcgccaacagcaac
ttcctcgccgacatcaacaacgagcgtccgctcaagaataccgcctaccgtgccaacctc
gcccgtctcaaccgcttcgccatgtacatgttcgaggatgataccatggtcaaccccaag
gagagcgcctggttcgccgaggtcaacgccaccaccggtgcggtgaccccgctccgcgag
cggagtctgtacaaggaggactggctggggctgaaggcgctggatgagcaggggaagttg
gactttcggaccgcccccggtggccatatgcagctgtcggagaagctgctgtcgaaggtc
ttcgaggagtatttcggtccggtcgaggtggacgttcccatgtccgttctgacgaagcag
ttgggccactaa

DBGET integrated database retrieval system