KEGG   Aspergillus clavatus: ACLA_041310Help
Entry
ACLA_041310       CDS       T01148                                 

Definition
palmitoyl-protein thioesterase precursor
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
act  Aspergillus clavatus
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ACLA_041310
  Lipid metabolism
   00062 Fatty acid elongation
    ACLA_041310
Enzymes [BR:act01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     ACLA_041310
Lipid biosynthesis proteins [BR:act01004]
 Fatty acid synthase
  Component type
   ACLA_041310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 323 aa AA seqDB search
MYLQSHLLLPLLSLPLISSASPLRTHGTELTPLPLIIWHGLGDDFQRDGMKEVAALADQA
NPGTYIHLIHVGDTAAADRQASFLGNVTEQIDLVCAQLAADPILSTAPAVNALGFSQGGQ
FLRGYVERCNAPPVHNLVTFGSQHNGIAEFQACGATDWVCRGAEALLRAGRWSAFVQARL
VPAQYFRDPAELDAYLANSNFLADINNERPLKNTAYRANLARLNRFAMYMFEDDTMVNPK
ESAWFAEVNATTGAVTPLRERSLYKEDWLGLKALDEQGKLDFRTAPGGHMQLSEKLLSKV
FEEYFGPVEVDVPMSVLTKQLGH
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtaccttcaaagtcacctcctcctccctctcctctccctccccctcatctcctccgca
tctcctctccgcacccatggaaccgaactcacccccctccccctgatcatctggcacggc
ctaggcgatgacttccaacgcgacggcatgaaggaggtcgccgcgctcgccgaccaagcc
aacccaggcacctacatccacctcatccacgtcggcgacaccgccgccgccgaccgccag
gcctccttcctcggcaacgtcactgagcagatcgacctcgtctgcgcccagctcgccgcg
gacccgatcctcagcaccgcacccgccgtcaacgccctcggcttctcgcagggcggccag
ttcctgcgcggctacgtcgagcgctgcaacgcgcccccggtccacaacctcgtcaccttc
ggcagccagcacaacggcatcgccgagttccaggcctgcggcgccaccgactgggtgtgc
cgcggtgccgaggccctgctgcgcgccggccgctggtccgccttcgtgcaggcccgcctc
gtccccgcccagtacttccgcgaccccgccgagctggacgcctacctcgccaacagcaac
ttcctcgccgacatcaacaacgagcgtccgctcaagaataccgcctaccgtgccaacctc
gcccgtctcaaccgcttcgccatgtacatgttcgaggatgataccatggtcaaccccaag
gagagcgcctggttcgccgaggtcaacgccaccaccggtgcggtgaccccgctccgcgag
cggagtctgtacaaggaggactggctggggctgaaggcgctggatgagcaggggaagttg
gactttcggaccgcccccggtggccatatgcagctgtcggagaagctgctgtcgaaggtc
ttcgaggagtatttcggtccggtcgaggtggacgttcccatgtccgttctgacgaagcag
ttgggccactaa

DBGET integrated database retrieval system