KEGG   Aspergillus clavatus: ACLA_044560Help
Entry
ACLA_044560       CDS       T01148                                 

Definition
Melibiase subfamily, putative
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
act  Aspergillus clavatus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ACLA_044560
  Lipid metabolism
   00561 Glycerolipid metabolism
    ACLA_044560
   00600 Sphingolipid metabolism
    ACLA_044560
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    ACLA_044560
Enzymes [BR:act01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ACLA_044560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 757 aa AA seqDB search
MGNEAVAKEWWGLGYLYSTKHPSLVQHGTGSTPYNLGIEYDMRSQTITLENTCIRVTVLI
DKDGAAYLQEVLPLPAISPTPSSPNFSNSYCYLLEARLAGEGTARNKSSKSLVGSYVGSR
LRYQSHEFENRPDSRTLHVRLLDDVTGATVTSHLTIYHGFPVLRATATIQNGGDKDIVVT
QLSSLVLGGLSAGSNRWWHEYKLSVPTNSWFREAQWGEHDLPSLGIDDYGVYGRPEYHWG
TLGHYSVSNRGTFSTEGHLPMGLLKRNDEKDSWLWQIENNGSWRWEIGDWKDNIYLAAGG
PVETDHDWRQRLAPGEQFTTVAVALCHVHDDYQKAFSAITRYRRHMRRKHCDNERLPIIF
NDYMNCLMGDPTEDKILALLDPVVQAGAEYFVIDAGWYADDSGWWDDVGQWEPSKKRFPS
GFQELLARIEQKGLVPGLWLEPEVIGVRSVVANQLPDEGFFQRDGHRIVEKDRFQLDYRN
SAVRKHMSNVIHRLVTEYGVGYFKFDYNIDVTQGTDVNCSSSGSGQLEHNRAYLKWVNEL
HDQYPHLVIENCSSGAQRMDYAMLAVHALQSSSDQQDPERYPAIVSALPTAVAPEQGAVW
AYPQPVWDDELNAMTVVNSLLGRVHLSGRLDLLQPHQFALIKEGMDVYKVIRADLKTAIP
FWPLGLPHWHDDWVSLGMSAQTAEGQDSGCYYVAVWRRGGDGSMMLPIRALQGQDMQIQT
IYPSALATEVQWVASEGCLVVTIPSELGARLIKLMVN
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgaggccgtcgccaaggaatggtggggtctgggatatctatactcaactaaa
cacccatcattggtgcagcatggcacgggctctactccgtacaatttaggtatagaatac
gatatgcggtcccaaaccatcaccctcgaaaatacttgcattcgggtcactgttctcatt
gacaaggacggagcagcatatctacaagaggtgcttccgcttcctgcaatctcgccgacc
ccatcttctcccaatttcagcaattcatattgctacctgttggaggcacgactagccggg
gagggaacagcgagaaacaagtcctctaagagcctggtaggaagttatgttggctctcgt
ttgcgatatcagtctcatgagttcgaaaatcgcccggatagtcggacccttcacgttcga
ttgctcgatgatgtgaccggagcgacagtgacatcccatctgacaatttatcatgggttt
cctgtgctccgtgccactgctacaattcaaaacggcggcgacaaggacattgttgtcaca
cagctgtcgtccctcgttcttggtggattgtcggccggctcgaacagatggtggcatgag
tacaagctctctgttcccacaaactcgtggtttcgagaagcacagtggggagagcatgac
ctaccgagtctgggtatcgatgactatggtgtctacggccgcccggagtatcattggggc
actctggggcattactctgtctccaatcgtggtaccttttccacagaggggcatttgccc
atgggactgttgaagcgaaatgatgaaaaagatagctggttgtggcaaattgaaaacaat
ggctcttggcgatgggagattggtgactggaaggacaacatctatcttgccgcgggaggc
cccgtagagactgaccacgactggaggcaacgactcgcgccgggagagcaatttaccaca
gtcgctgtggctctttgccacgtgcacgacgattatcagaaagccttttccgctataacg
cgatatcgacggcacatgcggcgcaagcattgcgacaatgagcggctacccatcatattc
aacgactacatgaattgtctaatgggcgatccaaccgaggacaagatactggctcttcta
gatccagtcgttcaggcaggcgccgaatactttgtcattgatgcgggttggtatgccgat
gattccggatggtgggacgacgtcgggcagtgggagccttccaaaaagcgcttcccctcg
gggtttcaagaactcctggcgagaatcgaacaaaagggtctcgtcccgggattatggctt
gagccagaagtgattggggtgcgcagtgtggtcgcgaaccaactcccggacgaagggttt
ttccaacgagacggccatcgcatcgtggaaaaagaccggtttcagctagactaccgaaat
tccgctgtacgaaaacacatgagcaatgtcatccatcggttggttaccgagtatggcgtg
ggatatttcaaatttgactacaatattgacgtgacccaaggtacagatgtcaactgctcg
agttctggatcagggcagctcgagcacaatcgtgcctatctcaaatgggtgaacgagctg
catgatcaatatccccacttggtaattgagaactgttcgagtggtgctcagcgaatggac
tatgccatgttggccgtgcacgcgttgcaatcatctagcgaccaacaagatcccgaacgg
tatcccgccattgtatcggcccttcccactgctgtcgctccagagcaaggtgcggtatgg
gcatatccacagccggtatgggacgacgagctcaatgcaatgacagtggtgaattcacta
cttggtcgcgtgcatctcagtggaagattggatcttctccagccgcatcagtttgctttg
atcaaagaaggcatggatgtatataaggtgatccgtgccgatctcaagacagcaattccg
ttctggcctcttgggctgcctcactggcatgacgactgggtttccctagggatgtctgca
cagacggcagaaggtcaagacagcggatgctattatgttgcggtttggagacggggcggc
gatggtagcatgatgctccccataagagcccttcagggtcaggatatgcaaatccagacc
atctatccttccgcattggctacagaggttcaatgggtcgcttcggagggctgcttggtg
gtgacaattccgtccgagctgggtgctcgtctgatcaagttgatggtcaattag

DBGET integrated database retrieval system