KEGG   Aspergillus clavatus: ACLA_045600Help
Entry
ACLA_045600       CDS       T01148                                 

Definition
longevity-assurance protein (LAC1), putative
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
act  Aspergillus clavatus
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:act00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 441 aa AA seqDB search
MAKDVSTQSQSVSELNTCVSAGHRAASKETTFREWMVTNQIGISLTILATLLAAHNLYPS
LRPYTAPFFQLSYYRPAQGDYVQGFDDVYFVISSAITFTAIRAISIEWVFQPAARFGGLK
RKNSIRVAEQAWMWVYYAFFCTFGMYIWANSNYWMDFKAIWAQWPARGVSGHLKWYLLAQ
LSFWFQQILVINIEERRKDHYQMLTHHVITSALLSSAYIYGFYNVSNVVLCLMDIVDLLL
PTAKILKYLKYELSCNITFVLFMVTWLVTRHILYPRLCWSIYKDVPDAMAYGCYSGTTAE
MISTNGYPDQFRYLFYPFLNIDGPICMNRTIKWIFLGFLLALQLLSIIWFVMVVRVAVGV
LRTGNAEDTRSDDEEENEVRTTAKDAMPASNTAITDGPNGDWRRTANGPTNVRSRGRGRV
RLGDQSDRKALLGRIGCDKPT
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagacgtgtccacgcaatcgcagtccgtctcggagctcaatacttgcgtttcc
gctggccatcgggctgcttccaaggagacgacctttcgagaatggatggtcacaaatcag
atcgggatttccttgacgatcctcgctacacttttggcggctcataacctctacccttcc
ctgcgaccgtataccgcgcccttcttccagttatcgtactaccggccggcccaaggggac
tatgtccagggctttgatgatgtgtacttcgtcatcagctccgccatcacattcaccgct
attcgtgcgattagcatcgaatgggtcttccaaccagccgccagatttggcggactgaag
cggaagaactccatccgcgttgctgagcaggcatggatgtgggtgtactatgcgttcttc
tgcacttttggcatgtacatctgggccaactcgaactactggatggacttcaaggccatc
tgggcccaatggccggcgcgcggtgtgtccggacacctgaaatggtatctcctcgcgcag
ctgtcgttctggttccagcagatcctggtaatcaatatcgaagagcgacgaaaggatcat
taccagatgttgacccaccatgtcatcacaagcgccctcctgagctccgcctacatctac
ggattctacaatgtgtcgaatgtcgtgctgtgcctgatggatatcgtggacctgttgcta
ccgaccgccaagatcctcaagtacctcaaatacgaactgtcctgcaatatcacctttgtc
ctgttcatggtgacctggttggtcacacgccatattttatacccgcgcctgtgctggtcc
atctataaggacgtacccgacgcaatggcctacggctgctactccgggaccacagccgag
atgatctctacgaacggctacccagaccagttccgctacctcttctacccgttcctcaac
atcgacggccccatctgcatgaaccgcacgatcaagtggatcttcctgggcttcctcctg
gccctccagctgctgtccatcatctggttcgtgatggttgttcgcgtggctgtcggcgtg
ctccgcaccggcaacgccgaggacacccgcagcgacgacgaggaggagaacgaggtccgc
actacggccaaggacgccatgccggccagcaacacagccatcaccgacgggccaaacggc
gactggcgccgcaccgcgaacgggccaaccaacgtgcggtcccgaggccggggacgagtc
cggctcggcgaccagagcgatcgcaaggccctgcttggccggatcggatgtgacaagccg
acgtag

DBGET integrated database retrieval system