KEGG   Aspergillus clavatus: ACLA_047060Help
Entry
ACLA_047060       CDS       T01148                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
act  Aspergillus clavatus
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:act00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    ACLA_047060
Exosome [BR:act04147]
 Exosomal proteins
  Proteins found in most exosomes
   ACLA_047060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1663 aa AA seqDB search
MAPLPIKFTELINTLESDHYVCVRQKLNEDDKPQVIILNLKNNNEVIKRPINADSAIMHW
SKNIIALRAQGRTIQIFDLTAKQKLKSAVMNEDVVYWKWFSEKCLGLVTEASVYHWDVFD
PTQNQPIKIFDRLPNLSGCQIINYRVNDDEKWMVVVGISQQQGRVVGSMQLYSKDRGISQ
FIEGHAAAFASIRVEGSPLEHKLFTFAVRTQTGAKLQIAEIDHQEPNPRFQKKAVEVYFP
QEAVNDFPVAMQVSRKYDIVYLVTKYGFIHLYDLETGTCIFMNRISSETIFTTAPDSDSA
GLVGVNRKGQVLSVSVDEGTIIQYLMENPAMSGLAVKLASKAGLPGADHLYQQQFDNLLA
QGNYSEAAKIAANSPRGFLRTPETINRFKNAPQTGQQMSVILQYFGMLLDKGSLNKYESV
ELVRPVLQQNRKHLLEKWTRENKLEASEELGDIVRPYDMNMALSIYLQANVPNKVIAGFA
ETGQFDKILSYSKQVGYQPDYTQLLQHIVRVNPEKGAEFAAQLANEESGALIDLDRVVDV
FLSQNMIQQATSFLLDALKDNKPEHGHLQTRLLEMNLVNAPQVADAILGNEIFTHYDRPR
ISQLCENAGLIQRALENTDDPAVIKRNIVRTDKLNPEWLMNYFGRLSVEQTIECMDTMLE
VNIRQNLQAVVQLATKFSDLLGPGRLISLFEKYRTAEGLYYYLGSIVNLSEDPEVHFKYI
EAATAMGQLTEVERICRESNYYNPEKVKNFLKEARLTEQLPLIIVCDRFNFIHDLVLYLY
QNQQYKSIEVYVQRVNPSRTPAVVGGLLDVDCDEAIIKNLLSTVEPSVIPIDELVSEVES
RNRLKLLLPFLEATLASGNQQQAVYNALAKIYIDSNNNPEKFLKENDLYDTLTVGKYCEK
RDPNLAYVAYRKGQNDLELINITNENSMYRAQARYLVERADSEIWSFVLSENNLHRRSLV
DQVIATAVPESTEPDKVSVAVKAFLEADLPGELIELLEKIILEPSPFSDNGSLQNLLMLT
AAKADKGRLMDYIHQLSEFSADEIAEMCISVGLYEEAFEIYKKVNNYIAAVNVLVENIVS
IDRAQEFAERVELPDVWSKVAKAQLDGLRVSDSIESYIRANDPSNYNEVIETAIHAGKDE
DLVKYLKMARKTLREPAIDTALAFCYARLDQLLELEDFLRSTNVADIETSGDKAYAEGYH
QAAKIFYTSISNWAKLATTLVHLEDYQAAVECARKANSVKVWKEVNLACVDKKEFRLAQI
CGLNLIVHAEELQDLVRQYERHGYFDELISVLEAGLGLERAHMGMFTELGIALSKYHPDR
VMEHLKLFWSRINIPKMIRACEEANLWPELVFLYCHYDEWDNAALAMMERAADAWEHHSF
KDIIVKVANLEIYYRALNFYLQEQPLLLTDLLQVLTSRIDVNRVVRIFQTSDNIPLIKPF
LLNVQNQNKRTVNDAINDLLIEEEDYKTLRDSVDNYDNFDAVELAQRLEKHDLIFFRQIA
ANIYRNNKRWEKSIALSKQDKLYKDAIETAAISGKSDVVEELLRYFVDIGSRECYVGMLY
ACYDLIRPDVILEMSWRHGLNDFTMPFMINFLCEQTRTIEMLKKDNEERKSREVTQQKEE
DNTPILGGSRLMLTQGPSTPAPAPMAYGQPNGIAPQATGFRPF
NT seq 4992 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcttcccatcaagttcacggagcttatcaatactctagaatctgaccattac
gtttgcgtccgccaaaaacttaatgaagatgataagcctcaggtcatcattctcaacctg
aagaataacaatgaggtcatcaagcgaccgattaatgcggacagtgctatcatgcactgg
tccaagaacatcattgctcttagagcccagggccgaacaatccagatcttcgatctcaca
gcgaagcagaaactcaagtctgcggttatgaacgaagatgtcgtctactggaagtggttc
agcgaaaagtgcttgggtctggtcacagaagcatccgtctaccactgggatgttttcgat
cctactcaaaaccagcccattaagatcttcgaccgtttgccaaacctaagtggctgccaa
atcatcaactaccgtgttaacgatgacgagaaatggatggtcgtggtcggtattagccaa
caacagggacgcgttgtgggctcaatgcagctctattccaaggaccgcggaatatcccag
ttcattgaaggtcatgctgcagcttttgcgtcgatccgagtggaaggatctcctctggag
cacaagttgttcactttcgctgttcgcacgcagactggcgcaaagctgcaaatcgccgag
atcgaccaccaggagccgaaccccagattccaaaagaaggcagtcgaggtctacttcccc
caggaagctgtcaacgacttcccggtcgccatgcaggtatccagaaagtacgacattgtt
tatttggttacgaagtatggctttattcatctctatgaccttgagactggtacctgcatt
tttatgaaccgtatctccagcgagaccatcttcactactgcccctgactccgactctgcc
ggtctggttggtgtcaaccgtaaaggtcaagtcttgtcggtcagcgttgatgagggaacc
attatccagtacctgatggagaatcctgccatgtctggactcgcggtcaaactcgcttcc
aaggctggccttcccggagcggatcacctctatcagcagcagttcgacaacctgttggcg
caaggcaattactccgaagccgcgaaaattgctgcaaactcccctcgcggattccttcgg
acaccggagacaatcaaccgctttaagaacgcaccacagactgggcagcagatgtccgtc
attctccagtatttcggcatgcttttggacaagggatctctgaacaaatacgagagtgtc
gagctcgtacgccctgtcctgcagcagaacagaaagcatcttctggaaaagtggacacgt
gagaacaagttggaggcctctgaagagctcggagacatcgttcgtccgtacgacatgaac
atggccctgtcgatttacctgcaagccaatgtacccaacaaggttatcgctggtttcgcc
gagaccggtcaattcgacaagatcctcagctattcgaagcaagttggataccagccggat
tacacacaactactgcaacacattgttcgcgtcaatcccgagaagggtgccgaatttgca
gctcaattggcaaatgaggaaagtggcgcgctcatcgaccttgaccgtgtcgtagatgtc
ttcctgtcgcagaacatgattcagcaggcaacctcattcttgctggatgcgctcaaggat
aacaagcctgagcatggtcacttgcaaacacgattgcttgagatgaacttggtcaacgcc
ccgcaggtcgctgatgcaatccttggcaacgagatcttcactcactacgaccgtcccaga
atctcccagctttgcgagaatgctggcctcattcagcgtgcattggagaacaccgacgat
cccgcggtgattaagcgcaacattgtccgaaccgataagctcaatcccgagtggctcatg
aactactttggccgtctttccgtggagcagaccatcgaatgcatggatactatgttggaa
gtgaacatccgtcagaatctacaggcagttgttcagctcgctacaaagttttccgatctc
cttggacccggccgcctcatcagtctgtttgagaaataccgaactgccgaaggtctctac
tattaccttggaagcattgtcaacctcagcgaggaccctgaggtgcacttcaagtatatt
gaggctgctactgccatgggccagctgactgaggtcgagagaatttgccgcgagagcaac
tattacaatccggagaaggtgaagaacttcctgaaagaagcccgactgaccgagcagctt
ccgctcatcatcgtctgtgatcgtttcaacttcatccacgacctggtcctctatctgtat
cagaaccagcaatacaaatccatcgaggtctacgtgcagcgtgtcaatccgtcccgcact
ccggcagtcgtgggaggattgttggatgttgactgtgacgaagccatcattaagaatctc
ctgtctactgttgaaccctctgttattcctatcgatgagcttgtatctgaggtggaaagc
cgtaacagattgaagttgctccttccattcctcgaagctactctggcttccggcaaccaa
caacaagcagtttacaacgctctcgcaaagatctacattgacagcaacaacaaccccgag
aagttcctcaaagagaacgacctttatgacacgttgaccgttggtaaatactgtgaaaag
cgtgatccaaacctggcctacgtcgcgtacaggaagggacagaatgatttggagctcatc
aatatcaccaacgagaactccatgtacagagcccaggctcgttacctggttgaacgcgcc
gattcagagatctggtcgtttgtgctgagtgagaacaacctgcatcgtcgttctcttgtc
gaccaggtcatcgcgacagcggtcccggagtcgactgaacccgacaaggtatccgttgct
gtcaaggctttcctcgaagccgacctgcctggcgaactcatcgagcttttggagaagatc
attctcgagccctcgccattcagtgacaacggtagcttgcagaatctgctgatgctgact
gccgccaaagccgacaagggacgtcttatggattacatccaccagctctccgagttcagt
gctgacgagatcgcggagatgtgtatttctgtgggtctgtatgaagaagcgtttgagatc
tataagaaggtcaacaactatatcgctgccgtcaatgttctcgttgagaacatcgtcagt
atcgatcgcgcgcaagaattcgccgaacgcgttgaattgccagatgtctggagcaaggtt
gcgaaagctcagcttgacggtcttcgtgtatctgactcgatcgagtcgtacattcgtgcc
aacgatccctccaattacaacgaggtaattgagaccgcaatccacgccggtaaagatgaa
gatctcgtcaagtatctcaagatggcccgcaagacattgcgtgagcctgccatcgacacc
gctcttgctttctgctatgctcgccttgaccagttgctggagcttgaggacttcctgcga
tccaccaatgtggccgatattgaaacatctggtgacaaggcttatgctgaaggataccat
caggcggctaagattttctacaccagcatctcgaactgggccaagctggccaccactctg
gtgcatttggaagactatcaagctgcagttgagtgtgcccgcaaggccaacagtgtcaag
gtctggaaggaggtcaacctggcatgtgttgataagaaggagttccgtctcgcacagatt
tgcggtctcaacctcattgtccatgccgaggagctgcaggatcttgtgcgccaatatgaa
cgccacggctacttcgatgagttgatcagtgtgctcgaagctggcttgggcctggagaga
gcccatatgggtatgttcactgagctgggcattgctctgtccaaataccaccctgaccgg
gttatggagcacctcaaactcttctggtctcgcatcaacatccccaagatgatccgagcg
tgcgaggaagccaatctctggccagaactggtgttcctgtactgccattatgatgaatgg
gataacgctgccttggctatgatggagcgtgccgctgatgcatgggaacatcactcgttc
aaggatatcatcgtcaaggttgccaacctggagatctattatcgtgctctgaacttctat
ctgcaggagcaacccctcctcctcaccgatctgctccaggtgctgacttcccggatcgat
gtcaaccgtgttgtgcgcattttccagacctcggataatatccctctgatcaagccattc
ctgttgaatgtgcagaaccagaacaagcggactgtcaacgatgccatcaatgatctgttg
atcgaggaggaagactacaagaccctccgtgactcggtggacaactatgacaacttcgat
gcggtggagttggcccagcgtctcgagaaacatgacctcatcttcttccggcagattgcc
gcgaacatctaccgcaacaacaagcgctgggagaagtcgatcgcgctgtcgaagcaggac
aagctttacaaggatgctattgagaccgcggcgatttctggcaaatcggacgtggtcgaa
gaactccttcgctactttgtcgatattggcagccgcgagtgctatgttggcatgctgtat
gcctgctatgatctcatccggcccgacgtgatcctggagatgtcgtggcgacacggtctc
aatgacttcaccatgcccttcatgattaatttcctttgcgagcagacccgcacaattgag
atgctcaagaaggacaatgaagagcgcaagtctcgggaagtaacgcagcagaaagaagag
gacaacacccccatcttgggcggctcgcggctcatgttgacacaaggcccatcaacgccc
gcgcctgctccgatggcatatggacagccgaacggtattgctccccaagcgaccggcttc
cgtccattctag

DBGET integrated database retrieval system