KEGG   Aspergillus clavatus: ACLA_048260Help
Entry
ACLA_048260       CDS       T01148                                 

Definition
aldose 1-epimerase, putative
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
act  Aspergillus clavatus
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:act00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 695 aa AA seqDB search
MTAAGSQYVLQAGLTSGMSATEGLMHSPHPKPVDPKMAEEFHVLPTDIVPDSQARVALRG
KVQDVLVPYMCIGAWSWGDKATWKYNAEEDLPKIRAAWTKLRQAGLTFVDTSHVYGDGES
ERICGQLFKNMNRDEFIIQTKWMSWPDMSNLLLQSQGPAHKLRTSLKNLGLHYVDVYLVH
GPIHPSMISTVAKGMADCVNLGLTRAVGVANYDKGEVIKMAEELDKHGIPLAVNQCEYSV
IRRHPEVHGLIRACRDRNIVFQGFASLAEGRLTDKYSRFNEPPRTYRFSSYPMHMLEPTL
NVLREIARERRVPVAAVALNFSINKGVIPVVGIRNPEQANQNMQALGWRLTQDEMRRIET
VSIEGDTTIFWQHVWSIMERSNKPSAIGVAASLPQPTVTFRENKIEATLPTGESVTVHLY
GATVTSWKLPNGQEQLFVSEKAHLDGSKPIRGGIPVVFPVFGPPPPNHATSSLPQHGFAR
NSNWEFLGKSSSESLAKKDGDDSVKLDFGLSHTMLSEEFQKAWPYEFGLVYSVTLTKDGL
ETSLQVQNKGTQNFDFQVLLHTYLRIDDIAQVRVKGLESKTYIDKTQNATTHTETSPALE
ISQETDRVYQSLDPKVPVIVSSASDDKPLFSVIREGLNDVVVWNPWIEKAKGMADFSPDE
AYKNMICVEAGSVAGWQTLEAGESWEGGQTIRPRL
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgacagccgcagggagccagtatgtcctccaagcaggattgacatccggtatgtcagcc
acggaggggctgatgcactcgcctcatccgaagcctgttgatcccaagatggctgaagag
ttccatgtgttgccgactgatatcgttccggactcccaggcccgagttgcactgcgagga
aaagtacaagacgttctggttccatacatgtgcatcggggcctggtcttggggtgataaa
gccacctggaaatacaacgcggaagaggatcttcccaagattcgcgctgcgtggacgaag
ctgcgacaggcagggttgacctttgttgatacatcccatgtctacggtgatggggagagc
gagcgtatctgtgggcaactcttcaagaacatgaaccgagacgagttcattatccagacc
aaatggatgtcgtggcccgacatgtcgaacctgttgctgcagtcgcaaggtccggcccac
aagctcagaacatcgttgaagaatctgggcctccactatgtggacgtctacctggttcac
gggccaattcaccccagtatgatctcaactgttgccaaggggatggcggactgtgtgaat
ttgggattgactcgagccgtcggggtcgccaattacgacaagggagaggtgatcaagatg
gccgaggagctcgacaagcatgggatcccactagcggtcaatcagtgcgaatactcggtt
atcagaagacatccagaagtccatggactcatccgcgcatgccgtgataggaacatcgtc
ttccaggggtttgcgtctctggcagagggccgcctgacggacaagtactctcgattcaac
gaacctccgcgaacatatcggttcagtagctaccctatgcacatgcttgagcccacactg
aacgtgctaagagagattgcgagagagaggcgagttcccgtggccgccgtggcattgaat
ttcagtatcaacaagggagtgattcccgtggtgggtattcgaaatcctgaacaagcgaac
caaaatatgcaggctctaggatggcgattgacacaggatgagatgcgaaggattgaaacc
gtcagtatcgaaggagataccaccatattctggcagcatgtctggtcaatcatggagcgc
tccaataagccctcagccatcggtgtggctgcctcattgccccaacccactgtcaccttc
cgggagaacaagatcgaggccaccttgcccaccggtgaatcggtgactgtccacctgtac
ggagcgacggtcacttcctggaagctaccaaatggccaggaacagctttttgtgagcgaa
aaggctcacctggatggctccaagcctatccgcggcggcatccctgtggttttccctgtc
ttcggtccccctcctcccaaccacgccacgtcctcccttccacaacacggctttgcgcgt
aactccaactgggagttcctgggcaagtcgtcatctgaatcgctcgcaaagaaggatggt
gatgactcggtcaagctcgactttggtctgtcccatacaatgctgagtgaggagttccag
aaggcttggccgtatgaatttggtctggtgtacagtgtcaccctgaccaaggacggtctg
gagacgtcgttgcaggttcagaacaaggggactcagaatttcgacttccaggtcttgttg
cacacttatctaagaattgatgacatcgcacaagttcgagtcaagggacttgagtctaag
acttacatcgacaagacccagaacgctaccacacacactgagacgtcacctgccttggag
atcagccaggagacagatcgcgtgtaccaatcgctagatcccaaggtccctgtcatcgtc
tcatctgcctcagatgataagccacttttctctgttatacgggagggcctgaacgacgtg
gttgtgtggaatccttggatcgagaaggcgaagggcatggctgatttcagcccggacgag
gcatataagaacatgatctgcgtcgaggctggctctgtggccggctggcagaccttggaa
gctggtgaatcctgggagggtggacagacaatccggccgagattgtga

DBGET integrated database retrieval system