KEGG   Aspergillus clavatus: ACLA_048480Help
Entry
ACLA_048480       CDS       T01148                                 

Definition
cytochrome c peroxidase Ccp1, putative
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     ACLA_048480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 366 aa AA seqDB search
MASAARSASRAFLRSTPATSSFRPAVRGARFALPAQGFRAASRRGYASEANSGKSSSSVF
LWAGLAVAGGAGAYFYLNGSDSVDSKNFVPSKEDYQKVYDAIAARLANETDYDDGSYGPV
LVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKIARDFLEPIKAQFPWITYS
DLWTLAGSCAIQELGGPTIPWRPGRQDRDVAACTPDGRLPDASKDQRHVRDIFYRMGFND
QEIVALMGAHALGRAHTDRSGFDGPWDFSPTVFSNEFFRLLAEETWQKKKWNGPTQFTDK
TTSTLMMLPSDMAMIKDKEFKKHVDRYAKDSDAFFKDFSDVFVKLLELGVPFTSKAEDRY
VFKPSE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggctgctagatctgcctctcgcgccttcctgcgctccactccggcgacctct
tccttccgtcccgctgtccgtggcgctcgctttgctcttcccgctcagggcttccgcgct
gcttctcgtcggggttatgcctcggaggccaactccggcaagtcctcctccagcgtcttc
ctgtgggctggtctggccgtcgccggtggtgctggtgcatacttctacctgaacggcagc
gattcggtggactccaagaacttcgtccccagcaaggaggactaccagaaggtgtacgat
gcgattgctgctcgtctggccaatgagaccgactatgatgatggcagctatggacctgtc
ctcgtccgcctcgcatggcacgcaagcggtacatatgacaaggagactggcaccggtggc
agcaacggtgccaccatgagattcgctcccgaatccgaccacggcgccaacgctggtctc
aagattgcccgggacttcctggagcccatcaaggcccagttcccctggatcacctactcg
gatctctggactttggccggttcctgtgccatccaggagctgggtggtcccaccatcccc
tggcgccctggccgtcaggatcgggacgtcgctgcctgcacccctgacggacgtctcccc
gacgcctccaaggaccagcgccatgtccgcgacatcttctaccgcatgggattcaatgac
caggagatcgtggccctgatgggtgcccatgccctgggccgtgctcacaccgaccgctct
ggcttcgatggcccctgggatttcagccctaccgtcttctccaacgagttcttccgcctc
ctcgccgaggagacgtggcagaagaagaagtggaacggacctacccagttcaccgacaag
accaccagcaccctgatgatgcttcctagcgacatggccatgatcaaggacaaggagttc
aagaagcacgttgaccgctatgccaaggatagcgatgccttcttcaaggacttctcggac
gtctttgtcaagctcctcgagctcggtgttcccttcaccagcaaggccgaggaccgctat
gtcttcaagccctctgaatag

DBGET integrated database retrieval system