KEGG   Aspergillus clavatus: ACLA_048770Help
Entry
ACLA_048770       CDS       T01148                                 

Definition
glycosyl hydrolase family 10 protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     ACLA_048770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 317 aa AA seqDB search
MVVLSKIFSCALFLSLGSAAAIDIRQTSSINNAFKSHGKKYFGTCGDQNTLSIPQNSAII
KADFGALTPENSMKWDATEPSRGKFNFAGADHLVNYAKQNGKLVRGHTLVWYSQLPAWVK
AISDKQTLTSVLKNHITTVMSRYKGQVYAWDVVNEIFEENGSLRNSVFYRVLGEDFVRIA
FETARAVDPHAKLYINDYNLDSANYGKTQAMVKHVKKWLAAGIPIDGIGSQSHLSQALSA
LASTGVSEIAITELDIKGANPSEYVAVTKACLEVKKCIGITVWGVSDKNSWRKDNSPLLF
DRNYNPKPAYNAIIAAL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtccttagcaagattttcagctgcgcgctcttcctctcgttgggctcggctgca
gccatcgacatacgccagacctccagcatcaacaatgccttcaagtcccacggcaagaag
tactttggcacctgcggcgaccagaacactctatccatcccgcagaactcagccatcata
aaggcagactttggcgccctgacgcccgagaatagcatgaagtgggatgccactgagcct
tcccggggaaaattcaactttgccggcgcggatcacctggtcaactatgctaagcagaat
ggcaagctggtccggggccacaccctagtctggtactctcagctccccgcgtgggttaag
gccatctcggacaagcagaccctgacctcggtgctgaagaaccacattaccaccgtcatg
agccgctacaagggccaggtctacgcttgggacgtggtcaacgagatcttcgaggagaac
ggcagcctgcgcaacagtgtcttctatcgtgtgctgggcgaggattttgtgcgcattgct
tttgagacggcgcgcgccgtcgatccccatgcgaagctgtacatcaacgactacaacctc
gactccgccaactatggcaagacccaggctatggtcaagcatgtcaagaagtggctggct
gctgggatccccatcgacggcatcggctcgcaatcccatcttagtcaagctctgtcggcc
cttgcttccactggtgtctccgaaatcgccatcaccgagctggatatcaagggtgccaac
cccagcgagtatgtggccgtgaccaaggcatgcctggaggtgaaaaagtgcatcggcatc
accgtctggggtgtctccgacaagaactcctggcgcaaggacaattcgcccttgctgttc
gaccgcaactacaaccccaagccggcttacaatgccattattgccgctctgtaa

DBGET integrated database retrieval system