KEGG   Aspergillus clavatus: ACLA_050040Help
Entry
ACLA_050040       CDS       T01148                                 

Definition
histone acetyltransferase, putative
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ACLA_050040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1081 aa AA seqDB search
MPATVLPAVEEPEARPPADLVDSDQDAEGEEETDLYEMDQQLQNAVHQAYSGEVADEDQD
ADYDEDLDAEGEPDTELTINGDNQNQGAESVGPVNVPDERRSVENNEDVVSATADGEGDP
VFDNQSDSDASASSSSSSESDAGEEEWEAESNGREDAEGDQPVRGNCIFCHQDEDHDPSE
EFEEYLTCAVCGDHSHRQCAREQNALDDTQDATSWRCPTCVREKLQPTTEQIDANRRIPR
QKKMRRELLPAHTGEEGSGFHSIFNTTDVNDQLLTGSRSLRKRKASSTEAGEHTPVLRKW
RRQSSLRSARAESGDHAFGGVDTLSPVRTRSRRTRGEEKDNCRIVLKQFGRLVISFRLND
TKMSKILNSRSRSQIRGRRTPKPTPVAQEPLSHFAPIPPAPYISPFYSFNDRETDESKSK
PYGGILSETDADTSRTLPTHVDRERFEVARQKAEEEWQRRVMEAESGGESVQHASQKVSG
PPSRIKYINFGGYEIETWYAAPYPEEYSRNRVLYICEFCLKYMNSDYVAWRHKLKCPAKH
PPGDEIYRDGSISIFEVDGRKNPVYCQNLCLLAKLFLGSKTLYYDVEPFLFYVMTEFDDL
GCHFVGYFSKEKRPSSANNVSCILTLPIHQRKGYGNLLIDFSYLLTRIEGKTGSPEKPLS
DMGLVSYRNYWRLILSYQLRNQKTPISVAELSERTGMTFDDVVSGLEGLRALVRDPVTKT
YALRLNYSYFEECIRNWEDKGYVQLNPSALVWTPYIMGRSNQSQFDRAPLHAVAPREDPE
EEEEEEEEEGEGAKQMVSEEEQQITGRLNGILHRPVNGIRHTESDNRLNKPAGPPSTHGF
SNTNGFHHRTTATASSSADAPSNPVAGIPPSRFEIYPPVQAPIFKRKPGRPFGSKSMYNK
VAITPTTARTSGRGTPRRASTLAAETPTANPGSTRRGRGAKPIDSSAPEPTNGETNGFVN
GDHQTSEDAPGEVQDTSQQVSADPETEILNHIGNGIEPGPANGTEISDSMPKIVDGDLPH
SEPRITSKGRGVENRGKLSRSTSRKSVVEKSEVTIPAEEIDTAQENKPAARDADGDAIME
T
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atgccggcaaccgtgctgccggccgtcgaggagccggaggcaaggcctccagcagatctg
gtggatagtgatcaggacgcagagggggaagaggagacagacctttatgagatggatcag
cagcttcagaatgcggttcaccaggcctactccggggaagttgctgacgaagaccaagat
gccgattacgatgaagatctcgacgcggagggcgaaccagacacggaattgactatcaat
ggcgataaccagaaccaaggcgctgaatcggtcggacctgtgaacgtgcccgatgaaaga
cgctctgttgagaacaatgaagatgttgtttcggcgacagccgacggggaaggcgatcca
gtctttgacaaccagagcgatagcgacgcatcggcttcctcttcgagcagttcggagtcg
gatgccggcgaagaggagtgggaagcggagagcaatggcagggaggatgcagaaggagac
caacccgtccgtgggaactgcatcttctgtcatcaagatgaggatcatgatcctagcgag
gagtttgaagaatatctaacatgcgctgtctgcggtgatcattcccatcgacaatgtgct
cgagaacagaatgcgctggatgacacacaagatgctacctcctggagatgcccgacttgt
gttcgggagaaattacagccaactaccgaacagatagatgcgaatcggcggatcccccgc
caaaagaagatgcgccgggagctcctaccagcacacactggcgaggaagggtccggtttc
cactcaattttcaataccacggacgttaacgatcagctcttgaccggctcaaggtcattg
cgaaagagaaaagcgtcttcgaccgaggcaggcgagcatacgcctgttcttcgaaagtgg
cgccggcaatcatcattgcgttctgcacgggctgaatccggagaccatgccttcggaggc
gtggatactctgtcaccagttcgaactcgttcccgacgcactcgtggcgaggaaaaagac
aattgtcgtatagtcttgaagcagtttgggcgacttgtcatctcgttccggctcaatgat
accaaaatgtcaaaaatcctcaattctcggagccgatcccaaattcgaggcagaagaacc
cccaaaccaacaccggtggcccaagaaccactgtcgcactttgctcccatcccccccgcg
ccctacatctctcccttctactcattcaatgatcgtgagacggacgaatcaaaatcaaaa
ccttacggtggcattctgtcagaaacggatgctgacacttctcgaaccttgcccacccat
gtcgaccgcgaaagatttgaagtcgcacggcagaaggctgaagaggaatggcagaggaga
gtcatggaggctgagagtggaggagaaagtgtccaacacgcttctcagaaggtctctggc
cctccatcgaggatcaagtacatcaactttggaggatacgagatcgagacctggtatgca
gcgccatatcccgaagagtacagtcgcaatcgggtgctctatatctgtgagttttgcttg
aaatacatgaactcagactatgttgcctggcggcacaagttgaaatgccctgccaagcat
cctccgggggacgagatctaccgtgatggttctatttcaatattcgaagtcgacggcaga
aaaaatccagtatactgccagaatctttgcttgcttgccaaactgttcctagggtccaag
accctatactatgatgttgaaccattcttgttctatgtcatgaccgaatttgacgacttg
gggtgccacttcgttgggtacttcagcaaagagaaacgacccagttcagcaaacaatgtc
tcttgcatccttaccctccctatccaccaaaggaaaggttacggcaaccttctcattgat
ttctcatacttgcttacgcgcattgaaggcaagacagggtcgccagagaagcctctttcc
gatatggggttggtatcctaccgaaattactggcggctcattctatcatatcaattgcgg
aatcagaagactccgatcagcgtcgcggagctctcagagcgaacaggaatgacctttgat
gatgtggtctctggattggaagggctacgtgcccttgtcagagatccggtgaccaaaacg
tacgctttgcgcctcaattacagctattttgaagagtgcattcgaaattgggaggacaaa
ggctacgttcaactcaaccctagtgctctagtctggactccttatatcatgggtcggagc
aaccagtcccaatttgaccgagctccgttacatgctgttgctccgcgagaagatccagag
gaagaggaagaggaggaggaggaggagggcgaaggggccaagcagatggtgagcgaggaa
gagcaacagattacagggcgtctcaatggaattctccatcgacctgtcaatggtatcaga
cataccgagtccgataatcgtttgaacaagcccgccggccctccctcgacacatgggttc
tcaaatactaacggcttccatcatcgcacaacggctacagccagctcgagtgccgatgcg
ccgtccaatccggtagcagggattccgccctctagatttgaaatttatcctccggttcag
gctcccatcttcaagagaaaaccgggacgaccgtttggaagcaagtctatgtacaataaa
gtggcaatcacacccacaactgctcgcacgagcggtcgtgggactccccggcgagcgtct
acgttggccgctgagacccctaccgcgaatccagggagtacccggcgcggacgtggcgcg
aagcccattgactcgtctgctccggagccgactaatggggagaccaatggattcgtgaat
ggtgatcatcagacttcagaagatgcccccggagaagtacaagacacttcgcagcaggtg
tccgcagacccggaaactgaaattctgaaccacatcgggaacggcatagaacccggtcct
gccaacggcaccgagatctcggactccatgccaaagatagtggacggggacctccctcat
tccgaaccccgaatcacatcgaaaggccgaggagtcgagaaccgagggaaactatcacgg
tccacaagccggaaatcagtagtggaaaagagcgaagtgaccatcccagcggaggagatc
gacacggcgcaagaaaacaagcctgctgcaagggatgcggatggggacgcgatcatggag
acatga

DBGET integrated database retrieval system