KEGG   Aspergillus clavatus: ACLA_050180Help
Entry
ACLA_050180       CDS       T01148                                 

Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
act  Aspergillus clavatus
Pathway
act00010  Glycolysis / Gluconeogenesis
act00620  Pyruvate metabolism
act00640  Propanoate metabolism
act00680  Methane metabolism
act01100  Metabolic pathways
act01110  Biosynthesis of secondary metabolites
act01130  Biosynthesis of antibiotics
act01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACLA_050180
   00620 Pyruvate metabolism
    ACLA_050180
   00640 Propanoate metabolism
    ACLA_050180
  Energy metabolism
   00680 Methane metabolism
    ACLA_050180
Enzymes [BR:act01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ACLA_050180
Lipid biosynthesis proteins [BR:act01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ACLA_050180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 4703893
NCBI-ProteinID: XP_001271972
UniProt: A1CI41
AA seq 670 aa AA seqDB search
MSDGDVKPRKPAVVLEAHEVDTFHVPKAFYEKHPTGPHLKDLDEYKKLYEESIRHPDTFW
ACMARELLTFDKDFQTTHIGSLENGDNAWFVEGQLNASFNCVDRHAIKNPNKVAIIYEAD
EPSEGRIITYGELLREVSRVAWVLKQQGVKKGDTVAIYLPMIPEAVVAFLACSRIGAVHS
VVFAGFSSDSLRDRVLDAGSKVVITTDEGKRGGKVIGTKRIVDEALKQCPDVTSVLVYKR
TGAEVPWTQGRDVWWHEEVEKYPNYLAAEPMNSEDPLFLLYTSGSTGKPKGVMHTTAGYL
LGAAMTGKYVFDIHDDDRFFCGGDVGWITGHTYVVYAPLLLGCSTVVFESTPAYPNFSRY
WDVIEKHKVTQFYVAPTALRLLKRAGDEHIHHKMEHLRILGSVGEPIAAEVWKWYFEKVG
KEEAHICDTYWQTETGSNVITPLGGITPTKPGSASMPFFGIEPAIIDPVSGEEISGNDVE
GVLAFKQAWPSMARTVWGAHKRYMETYLNVYKGYYFTGDGAGRDHDGYYWIRGRVDDVVN
VSGHRLSTAEIEAALIEHHQVAEAAVVGIADELTGQAVNAFVSLKEGTESSEQVRKDLVM
QVRKSIGPFAAPKAVYVVEDLPKTRSGKIMRRILRKILSGEEDSLGDTSTLSDPSVVDKI
IGTVHAARGK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacggcgacgttaagcctcggaagccggccgtggtccttgaggcccacgaagtc
gatactttccatgttcccaaggcgttctacgagaagcaccccacaggtcctcacctgaaa
gaccttgatgagtacaagaagctatacgaggagtccattcggcaccccgacactttctgg
gcctgcatggcccgcgagctgctcactttcgacaaagacttccagaccactcacatcggt
tcgctcgagaacggcgacaatgcctggttcgttgagggccagctgaatgcctcgttcaac
tgtgtggaccgtcatgcgatcaagaaccccaacaaggtggccatcatctacgaggccgac
gagcccagcgagggccgtatcatcacctatggcgaattgctccgtgaggtctcccgcgtc
gcgtgggttctgaagcagcagggcgtcaagaagggcgacactgtcgctatctacctcccc
atgattcccgaagccgttgtagctttcctcgcctgctcccgtattggcgccgttcactcc
gtcgtctttgccggtttctcttccgattccctccgtgaccgtgttctcgacgccggctct
aaggtcgtcatcaccactgatgagggtaagcgtggcggcaaggtcatcggcaccaagcgc
atcgtcgacgaggctctcaagcagtgcccagatgtcaccagtgtgctcgtctacaagcgt
accggggctgaggttccctggacccagggtcgcgatgtttggtggcacgaggaggttgag
aaataccccaactatcttgccgccgagcccatgaactccgaggatcctctcttcttgctc
tacacctccggttccaccggtaagcctaagggtgtcatgcacactaccgctggctacctg
ctcggcgcggccatgactggcaagtacgtctttgacattcacgacgatgatcgcttcttc
tgcggtggtgacgttggttggattaccggtcacacctatgtcgtctatgcgcctttgctc
ttgggttgctcgaccgtggtcttcgagagcactcccgcctaccccaacttctcccgctac
tgggatgtcattgagaagcacaaggtcacccaattctatgttgcgcccactgctctgcgt
ctgctgaagcgtgccggagacgagcacatccaccacaagatggagcacctgcgtatcctg
ggttcggtcggtgaacccatcgcagctgaggtgtggaagtggtacttcgagaaggtcgga
aaggaggaggcccacatttgcgacacatactggcaaaccgagaccggttcgaacgtcatc
actcccctgggtggcattacacccaccaagcctggcagtgcctcgatgcccttctttggc
attgagcccgctatcattgaccccgtgtctggcgaggagatttccggtaacgacgtggag
ggcgtgcttgccttcaagcaggcctggcctagcatggcccggacggtgtggggcgcccac
aagcgctatatggagacctacctgaatgtctacaagggctactacttcacgggagacggt
gctggccgtgatcacgacggatactactggattcgtggccgtgttgatgacgttgtcaac
gtttctggacaccgtctgtctactgctgagattgaagccgctcttattgaacaccaccag
gttgccgaagctgcagtggttggtattgccgatgagctgaccggccaggccgtgaatgcc
tttgtttcgctcaaggagggcactgagtcgagcgagcaagtccgcaaagatcttgtgatg
caggtccgcaagtcgattggacctttcgccgctcccaaggcggtttatgttgtggaggac
cttcccaagactcgcagtggtaagatcatgcgccgtattctgcgcaagatcttgagcggt
gaagaggatagcctgggtgacacctcgactctgtccgatccttctgtggtcgacaagatc
attgggactgtccatgctgctagaggcaaataa

DBGET integrated database retrieval system