KEGG   Aspergillus clavatus: ACLA_050620Help
Entry
ACLA_050620       CDS       T01148                                 

Definition
glycerol kinase, putative
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
act  Aspergillus clavatus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:act00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 570 aa AA seqDB search
MRNPFDMTDLDHLVEEHHAHDAHSHANLSAYQSYDGERSLLQNESRRGDNLKDRFIGAID
QGTTSSRFIIFDCTGVPVAKYQTEFRQIHEYSGWHEQDPLELVDSVYTCIEEAMKTFLAL
GHSKSEIEAIGITSQRETALCWDSETGEPLHNAIAWPDTRTKNLVRELKEQDGADKVAGI
CGLPLSTYPSSVSLVWLLRHSPRVKQAYDEGRLCFGTVDSWLIYNLNGGPEGERHVTDVT
NASRTMFMNLETLDYDDTLLDFFHLDKKKIRLPKILPSSDPDGYGTVRFGPLAGVPITSC
LGDQSAALVGHCAFTPGSAKNTYGTGCFLLYNVGEKPVISKHGLLATVGFQLGKDRKPVY
ALEGSVAVAGSGISFLMNNLGFFRDSRKVSDLAATVPDSGGCVFVTAFSGLFAPYWIDDA
KGTIFGITQHTQRGHIARATMEAACFQTKAILDAMAMDSGHKLSELAVDGGMSNSDICMQ
TQADIIQIPVERPAMHETTALGAAIAAGFAIDVWKEFSELKNMNRANRTTFTPRISPLQS
GRMYKQWSKAVEMSRGWLDASEIVSEGPQD
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaccctttcgatatgaccgacctggatcacctcgtcgaagagcaccacgctcat
gacgcacacagccatgcaaatctctccgcctatcaatcgtacgacggcgagcgctcactt
cttcaaaacgaaagccgtcgaggcgacaatctaaaagaccgtttcatcggagccattgat
caaggaactacaagttcacgcttcatcatcttcgactgcacaggcgtccccgtcgccaaa
tatcagaccgaattccgtcagatccacgagtattcaggatggcacgaacaagatcccctc
gagctggtggattccgtctatacctgcatcgaagaagccatgaagaccttcctcgccctc
ggtcacagcaaatccgaaatcgaagcgatcggcatcaccagtcagcgagaaacagccctc
tgctgggattccgaaaccggtgagccgttacacaatgccatcgcctggcccgacacccgg
accaagaatctcgttcgcgagctcaaagaacaagacggcgcggataaggttgcgggcatt
tgcggtctacccctctccacatacccctcttccgtctcattagtatggctcctgcgccac
agtccccgagtcaagcaggcttatgacgagggacgactctgctttggcaccgtggattca
tggctgatctacaaccttaacggcgggcccgaaggtgaacgccatgtcaccgatgtcacc
aatgcttcccgaaccatgttcatgaacctggaaacgctggactacgacgacaccctgttg
gacttcttccacctggacaagaagaagatccgactgcccaagattcttccgtcgtcggat
cctgatggctacggcactgtccgtttcggcccgctggcgggtgttcccatcaccagctgt
ctgggagaccagtcggcagcgttggtgggccactgcgccttcacccccggatcggcgaag
aatacctacggcacggggtgctttttgctctacaacgtaggcgaaaagcctgtcatctcc
aaacacggcctgctggccacggtgggcttccaattaggcaaggatcgcaaacccgtctat
gccttggaaggtagcgtggcggttgccggtagcggtatctccttcctgatgaacaatctg
ggctttttccgtgattctcgaaaggtcagtgacctggcagcgacggttcccgacagcggt
ggctgtgtgttcgttacggctttcagcggtctgtttgctccctactggattgatgatgcc
aagggaaccatcttcggcatcacacaacacacacaacgcggtcacattgcccgcgcaacc
atggaagctgcctgcttccagaccaaggcgatcctcgacgccatggccatggacagcggc
cacaaactgtccgaactcgctgtcgacggcggcatgagcaattccgacatttgcatgcag
acccaagccgacattatccaaatccccgtcgaacgccccgccatgcacgagaccactgcg
ctgggcgccgccatcgctgcgggctttgccatcgacgtgtggaaggaattcagcgaactc
aagaacatgaaccgcgccaaccgcacgaccttcacgccacgcatctcccccttacagagc
ggccgcatgtacaagcaatggtccaaggccgtcgagatgtctcgcggctggctggatgca
agcgagatcgtatccgagggaccccaggattga

DBGET integrated database retrieval system