KEGG   Aspergillus clavatus: ACLA_050970Help
Entry
ACLA_050970       CDS       T01148                                 

Definition
Formamidopyrimidine-DNA glycosylase, putative
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
act  Aspergillus clavatus
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:act00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    ACLA_050970
Enzymes [BR:act01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     ACLA_050970
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     ACLA_050970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 369 aa AA seqDB search
MPELAEVSRIVHFLSEYVVGKTLTKVTTTNDDIVYGKAGTSASEFQKAMEGKRVVSAGQQ
GKYFWMIMSEPPHAVMHFGMSGWLKFDGVDTYYYRSDKHEDEEWPPKHWKFLLETDGEPK
TEAAFVDVRRLSRVHLVDCPAEDIRKYSPLKNHGPDPILDKNILTEEWLAKKIKSKKVPV
KVFLLDQANISGIGNWMGDEILYHAKIYPEQYSNTLTDEQIKQLYSSINYVCTTAVHLLA
DSEQFPKDWLFKYRWGKGKKNHTSVLPNGEKIIFLTVGGRTSAVVPSVQKKTGPVAKDIS
EEDIDVPKSETKRKRATAVEKEEEVDGVEEKPKPKKQGLSRRSKPSEDAVESKAESITQG
RRRSTRLRK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattagctgaggtttcccggatagtgcactttctttcagaatatgtcgttgga
aaaactcttaccaaagtcactacgacgaacgatgatatcgtgtacggcaaggctgggacc
agtgcttcggagttccagaaagcaatggaggggaaaagggttgtctcggcaggacagcaa
ggcaaatacttttggatgatcatgtcggaacctccccatgctgtcatgcattttgggatg
tctggctggctcaagtttgacggtgttgatacatactactatcgcagcgacaaacatgaa
gacgaggaatggccacccaaacactggaaattccttctcgaaacagacggagagcctaaa
acagaggctgctttcgtcgacgttcgcagattaagtagggtccacctcgtggactgccca
gcagaggatatccgcaaatatagtcccctcaagaatcatggaccagatccgatcctcgat
aaaaacattctcactgaggagtggctggcgaaaaagatcaagagcaagaaggtccctgtc
aaggtctttcttctggatcaggcgaacatcagtggaatagggaactggatgggcgacgag
atcttgtaccatgcaaagatttatccggagcaatatagcaatacccttactgatgagcag
atcaaacagctctattcttcgataaattatgtctgcacaactgcagtgcacctgctggcc
gattcggaacaattccctaaggactggctgttcaaataccgttggggtaaaggaaagaag
aatcatacctcagtcttgcccaatggggagaaaatcatcttcctgactgtgggaggcagg
acaagtgctgtagtcccaagcgttcaaaagaagactggccccgttgctaaggacattagc
gaggaagatatcgatgtcccaaaaagtgagacaaagcggaagcgtgcgacggccgtggaa
aaagaggaggaagtggatggtgttgaagagaagcccaagcctaagaagcaaggattgagc
agacgaagtaaaccatccgaggatgccgtggaatcaaaagcagagtcaatcacgcaagga
agacggcgttccacacgtttgaggaaatga

DBGET integrated database retrieval system