KEGG   Aspergillus clavatus: ACLA_051640Help
Entry
ACLA_051640       CDS       T01148                                 

Definition
histone acetyltransferase (Gcn5), putative
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ACLA_051640
Transcription machinery [BR:act03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     ACLA_051640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 415 aa AA seqDB search
MPALTSEGTKRKASEEAASPDFQKQIKKARTDSPDRELKIEEEPLDKPPLRIVPFPEKPA
VLEERRGEIEFRVVNNDGARDSFVVLTGLKCIFQKQLPKMPKDYIARLVYDRSHLSIAIV
KHPLEVVGGITYRPFNGRKFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKATSPIMHFLT
YADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTIMQCTMLPKIRYLEAGRMLLKQK
EAVQAKIRAFSRSHIIHAPPKEWKNGPCKIDPLSIPAIKESGWSPDMDELARQPRHGPNY
NQLLHLLNDMQNHSAAWPFTQPVNRDEVPDYYEVIKEPMDLSTMEEKHEKDMYPTPQDFI
KDAMLIFDNCRKYNNENTPYAKSANKLEKFMWQQIRNIPEWSVSVIQKRCTMLLV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgccggcactcacgtcagaaggtaccaagcggaaagcttcggaagaggcggcttccccg
gatttccagaaacagatcaagaaagcgcgcactgactctccagacagagagctaaagatt
gaggaggaaccgctggacaagccaccactgaggatcgtccccttccctgaaaagcccgca
gtcttggaagaacgacgaggtgaaatcgagtttcgagtggtcaataatgatggcgcgcgg
gatagtttcgtcgtccttaccggattgaagtgcatctttcagaaacagctcccgaaaatg
ccaaaggattacattgcgcggcttgtctacgatcgatcgcatctatccattgccattgtg
aagcatccgttggaggtggtaggagggatcacgtaccgtccattcaatggccgcaaattc
gcggaaattgtcttttgcgccatttcatctgatcagcaagtcaagggttatggtgcgcat
ctcatgtcgcatctcaaggactacgtgaaagcgacctcgcccataatgcattttctgacg
tatgcggacaactatgcgattggttattttaagaaacaagggttcacgaaagagattacg
ctcgataaatcgatctggatggggtacatcaaggattacgagggaggaacgataatgcaa
tgcacgatgctgcccaagatacggtatctcgaggcaggccgcatgcttctgaagcagaaa
gaagccgttcaggcgaagattcgagcgttcagccgctcgcatatcatccacgcgccgcca
aaggagtggaagaatggcccgtgcaagatcgatcctttgagtattcccgctatcaaagag
tccggatggtccccagacatggatgagctggcgcgccagccacgccatgggccgaattat
aaccagctgctacatctgcttaatgatatgcagaaccatagtgctgcttggccattcacc
cagcccgtcaaccgggacgaggtgcccgactactatgaagtcatcaaagagccaatggat
ctctcgaccatggaagagaagcacgagaaggacatgtatccgacaccgcaggacttcatc
aaagatgccatgttgatctttgataattgtcggaagtacaataacgagaacacgccgtat
gcaaagagtgcgaacaagctggagaaatttatgtggcagcagatccgcaacatcccagag
tggtcggtgagtgtcatccagaaacgatgcactatgttattggtttga

DBGET integrated database retrieval system