KEGG   Aspergillus clavatus: ACLA_052480Help
Entry
ACLA_052480       CDS       T01148                                 

Definition
(RefSeq) isocitrate lyase AcuD
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
act  Aspergillus clavatus
Pathway
act00630  Glyoxylate and dicarboxylate metabolism
act01100  Metabolic pathways
act01110  Biosynthesis of secondary metabolites
act01200  Carbon metabolism
Module
act_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ACLA_052480
Enzymes [BR:act01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ACLA_052480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 4703848
NCBI-ProteinID: XP_001272201
UniProt: A1CIS0
AA seq 538 aa AA seqDB search
MGYLEDEDQKYLDDVQAVKAWWTDSRWRYTKRPYTAEQIVAKRGNLKIQYPSNDQSKKLW
NILESNFEKKVASYTYGCLEPTMLTQMAKYLDTVYVSGWQSSSTASSTDEPSPDLADYPM
NTVPNKVNQLFLAQLFHDRKQREERITTPKDQRSKLANIDYLRPIIADADTGHGGLTAVM
KLTKLFIERGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQADIMGTDLLA
VARTDSEAATLITSTIDHRDHGFILGSTNPNLQPLADLMVAAEQAGKSGAELQAIEDQWT
AQAGLKLFNEAVVDAIKQGSQGNTDALIKEYLTAAKGKSNREARAIAKGITGTDIHWDWD
APRTREGYYRYQGGTQCAINRAVAYAPFADLIWMESKLPDYAQAKEFADGVHAVWPEQKL
AYNLSPSFNWKKAMPREEQETYIKRLGALGYAWQFITLAGLHTTALISHQFAKAYSQHGM
RAYGELVQEPEMEQGVDVVTHQKWSGANYVDNLLKMVTGGVSSTAAMGKGVTEDQFKH
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgggttacctcgaagacgaagatcaaaagtacctggacgacgtccaggccgtcaaggct
tggtggacggactcgagatggagatacaccaagcgtccttacaccgcggagcagatcgtc
gcgaagcgtggaaacctgaagatccagtacccttccaatgaccagagcaagaagctgtgg
aacatcctggaaagcaacttcgagaaaaaagtcgccagctacacctatggctgtctcgag
cccacaatgctcacccagatggccaagtacctcgacaccgtctatgtctccggctggcag
agctcgtccacagcctcgtctaccgatgagccttcccccgatcttgccgattaccccatg
aacactgtccccaacaaggtcaaccagctcttcctcgctcagctgttccatgaccggaaa
cagcgcgaggagcgcatcacaactcctaaggaccagcgctcgaaactcgccaacatcgat
tacctgcgtcccatcattgccgatgctgataccggtcacggtggtctcactgctgtcatg
aagctgaccaagctgttcatcgagagaggtgctgctggtatccacattgaggaccaggcc
cctggtaccaagaagtgtggccacatggctggaaaggtcctcgtccctatcagcgagcac
atcaaccgtctggttgccatccgtgcccaggccgatatcatgggaaccgatctccttgcc
gttgcccgtaccgactccgaagccgccaccctcatcacctcaaccatcgaccaccgtgat
cacggcttcattctcggctcgaccaaccccaacctccagcccctggccgacctcatggtc
gccgccgagcaagccggaaagagcggtgccgagctccaggctattgaggatcagtggacc
gctcaggctggcctgaagctgttcaacgaggctgtcgtcgacgccatcaagcagggttct
cagggcaacacggacgctctgatcaaggagtacctgactgccgccaagggcaagagcaac
cgcgaggctcgtgcgatcgccaagggcatcaccggcactgacatccattgggattgggat
gctcctcgtacccgtgagggttactaccgctaccagggaggcacccagtgcgccatcaac
cgtgctgttgcctatgctcctttcgccgatctgatctggatggagagcaagctccctgac
tacgcccaggccaaggagttcgccgacggtgtgcacgccgtctggcccgagcagaagctc
gcatacaacttgtcgccttccttcaactggaagaaggccatgccccgtgaggagcaggag
acctacatcaagcgtctcggcgctctgggctatgcctggcagttcatcaccctggccggt
ctgcacaccaccgccctcatctcccaccagttcgccaaggcctactcgcagcacggaatg
cgcgcgtacggcgagctggtgcaggagcccgagatggaacaaggcgtagacgtcgttact
caccagaagtggagtggtgccaactatgttgataacctcctgaagatggtcactggcggt
gtcagcagcacagcagccatgggcaagggtgtgaccgaggaccagttcaagcactga

DBGET integrated database retrieval system