KEGG   Aspergillus clavatus: ACLA_052480Help
Entry
ACLA_052480       CDS       T01148                                 

Definition
isocitrate lyase AcuD
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
act  Aspergillus clavatus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:act01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:act00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 538 aa AA seqDB search
MGYLEDEDQKYLDDVQAVKAWWTDSRWRYTKRPYTAEQIVAKRGNLKIQYPSNDQSKKLW
NILESNFEKKVASYTYGCLEPTMLTQMAKYLDTVYVSGWQSSSTASSTDEPSPDLADYPM
NTVPNKVNQLFLAQLFHDRKQREERITTPKDQRSKLANIDYLRPIIADADTGHGGLTAVM
KLTKLFIERGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQADIMGTDLLA
VARTDSEAATLITSTIDHRDHGFILGSTNPNLQPLADLMVAAEQAGKSGAELQAIEDQWT
AQAGLKLFNEAVVDAIKQGSQGNTDALIKEYLTAAKGKSNREARAIAKGITGTDIHWDWD
APRTREGYYRYQGGTQCAINRAVAYAPFADLIWMESKLPDYAQAKEFADGVHAVWPEQKL
AYNLSPSFNWKKAMPREEQETYIKRLGALGYAWQFITLAGLHTTALISHQFAKAYSQHGM
RAYGELVQEPEMEQGVDVVTHQKWSGANYVDNLLKMVTGGVSSTAAMGKGVTEDQFKH
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgggttacctcgaagacgaagatcaaaagtacctggacgacgtccaggccgtcaaggct
tggtggacggactcgagatggagatacaccaagcgtccttacaccgcggagcagatcgtc
gcgaagcgtggaaacctgaagatccagtacccttccaatgaccagagcaagaagctgtgg
aacatcctggaaagcaacttcgagaaaaaagtcgccagctacacctatggctgtctcgag
cccacaatgctcacccagatggccaagtacctcgacaccgtctatgtctccggctggcag
agctcgtccacagcctcgtctaccgatgagccttcccccgatcttgccgattaccccatg
aacactgtccccaacaaggtcaaccagctcttcctcgctcagctgttccatgaccggaaa
cagcgcgaggagcgcatcacaactcctaaggaccagcgctcgaaactcgccaacatcgat
tacctgcgtcccatcattgccgatgctgataccggtcacggtggtctcactgctgtcatg
aagctgaccaagctgttcatcgagagaggtgctgctggtatccacattgaggaccaggcc
cctggtaccaagaagtgtggccacatggctggaaaggtcctcgtccctatcagcgagcac
atcaaccgtctggttgccatccgtgcccaggccgatatcatgggaaccgatctccttgcc
gttgcccgtaccgactccgaagccgccaccctcatcacctcaaccatcgaccaccgtgat
cacggcttcattctcggctcgaccaaccccaacctccagcccctggccgacctcatggtc
gccgccgagcaagccggaaagagcggtgccgagctccaggctattgaggatcagtggacc
gctcaggctggcctgaagctgttcaacgaggctgtcgtcgacgccatcaagcagggttct
cagggcaacacggacgctctgatcaaggagtacctgactgccgccaagggcaagagcaac
cgcgaggctcgtgcgatcgccaagggcatcaccggcactgacatccattgggattgggat
gctcctcgtacccgtgagggttactaccgctaccagggaggcacccagtgcgccatcaac
cgtgctgttgcctatgctcctttcgccgatctgatctggatggagagcaagctccctgac
tacgcccaggccaaggagttcgccgacggtgtgcacgccgtctggcccgagcagaagctc
gcatacaacttgtcgccttccttcaactggaagaaggccatgccccgtgaggagcaggag
acctacatcaagcgtctcggcgctctgggctatgcctggcagttcatcaccctggccggt
ctgcacaccaccgccctcatctcccaccagttcgccaaggcctactcgcagcacggaatg
cgcgcgtacggcgagctggtgcaggagcccgagatggaacaaggcgtagacgtcgttact
caccagaagtggagtggtgccaactatgttgataacctcctgaagatggtcactggcggt
gtcagcagcacagcagccatgggcaagggtgtgaccgaggaccagttcaagcactga

DBGET integrated database retrieval system