KEGG   Aspergillus clavatus: ACLA_052670Help
Entry
ACLA_052670       CDS       T01148                                 

Definition
(RefSeq) MAP kinase MpkA
Organism
act  Aspergillus clavatus
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 422 aa AA seqDB search
MSDIHGRKVFKVFNQDFVVDERYNVTKELGQGAYGIVCAATNVQTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPEE
NAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKVPFQRLFPNANPDALDLLDRMLAFDPA
SRISVEEALEHPYLHIWHDASDEPTCPTTFDFHFEVVDDVQEMRKMIYDEVVRFRTLVRQ
QSQAQAAAAAQQQQIAQQTNVPIPEHQQGSWKHEDPKPQEASAAGGHTNDLESSLQRGMD
VQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatatacacggccgcaaggtcttcaaggtcttcaaccaggactttgtcgttgat
gaacgctacaatgtgaccaaggaactgggccagggtgcatacggtattgtctgtgctgcc
acaaacgttcagacaggcgaaggcgtcgctatcaagaaggtgaccaatgtcttcagcaag
aagatcctagccaagcgcgccttgagagagatcaagctcctccagcacttccgaggccac
cgcaacatcacttgtctatatgacatggacattccacgaccggacaatttcaatgagacc
tatctctatgaggagttgatggaatgcgatctggctgcgatcatccgttcgggccagccc
ctgaccgacgctcatttccagtccttcatctaccagatcctgtgcggtctcaagtatatc
cattccgccaatgtcttgcatcgagacttgaaacccggtaacctgctggtcaatgcggat
tgcgagcttaagatttgtgatttcggcctggcccgtggtttctcgatcgatcccgaggag
aatgcaggctacatgaccgagtatgtcgcgacacgttggtaccgtgcccctgagatcatg
ttgagcttccagagctacaccaaagccatcgatgtgtggtccgtggggtgcatcctggca
gagctgctcggtggccggcccttcttcaagggccgagactacgtcgaccagctcaaccag
atcctgcactatctgggtactccgaacgaggagacgctcagccgtatcggctctcctcgg
gcccaggagtatgtgcgcaacctgcctttcatgcccaaggtccccttccagcgcctgttc
cccaacgccaaccccgacgcccttgacctgctcgatcgcatgctggccttcgatccggcg
tcgcggatctccgtcgaggaggcgctggaacacccgtacctgcacatctggcacgacgcc
tcggacgagcccacctgcccgacgacgttcgacttccacttcgaggtggtggacgacgtg
caggagatgcgcaagatgatctacgacgaggtggtgcgcttccgcacgctcgtccggcag
cagtcgcaggcgcaggccgccgccgccgcccagcagcagcagatcgcgcagcagactaac
gtgcccatcccggagcaccagcaaggctcctggaagcacgaggaccccaagcctcaggag
gcgagtgccgcgggcggccatacgaacgatctggaatcgtccttgcaacggggaatggac
gtgcaatga

DBGET integrated database retrieval system