KEGG   Aspergillus clavatus: ACLA_052670Help
Entry
ACLA_052670       CDS       T01148                                 

Definition
MAP kinase MpkA
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
act  Aspergillus clavatus
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:act04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 422 aa AA seqDB search
MSDIHGRKVFKVFNQDFVVDERYNVTKELGQGAYGIVCAATNVQTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDNFNETYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPEE
NAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKVPFQRLFPNANPDALDLLDRMLAFDPA
SRISVEEALEHPYLHIWHDASDEPTCPTTFDFHFEVVDDVQEMRKMIYDEVVRFRTLVRQ
QSQAQAAAAAQQQQIAQQTNVPIPEHQQGSWKHEDPKPQEASAAGGHTNDLESSLQRGMD
VQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatatacacggccgcaaggtcttcaaggtcttcaaccaggactttgtcgttgat
gaacgctacaatgtgaccaaggaactgggccagggtgcatacggtattgtctgtgctgcc
acaaacgttcagacaggcgaaggcgtcgctatcaagaaggtgaccaatgtcttcagcaag
aagatcctagccaagcgcgccttgagagagatcaagctcctccagcacttccgaggccac
cgcaacatcacttgtctatatgacatggacattccacgaccggacaatttcaatgagacc
tatctctatgaggagttgatggaatgcgatctggctgcgatcatccgttcgggccagccc
ctgaccgacgctcatttccagtccttcatctaccagatcctgtgcggtctcaagtatatc
cattccgccaatgtcttgcatcgagacttgaaacccggtaacctgctggtcaatgcggat
tgcgagcttaagatttgtgatttcggcctggcccgtggtttctcgatcgatcccgaggag
aatgcaggctacatgaccgagtatgtcgcgacacgttggtaccgtgcccctgagatcatg
ttgagcttccagagctacaccaaagccatcgatgtgtggtccgtggggtgcatcctggca
gagctgctcggtggccggcccttcttcaagggccgagactacgtcgaccagctcaaccag
atcctgcactatctgggtactccgaacgaggagacgctcagccgtatcggctctcctcgg
gcccaggagtatgtgcgcaacctgcctttcatgcccaaggtccccttccagcgcctgttc
cccaacgccaaccccgacgcccttgacctgctcgatcgcatgctggccttcgatccggcg
tcgcggatctccgtcgaggaggcgctggaacacccgtacctgcacatctggcacgacgcc
tcggacgagcccacctgcccgacgacgttcgacttccacttcgaggtggtggacgacgtg
caggagatgcgcaagatgatctacgacgaggtggtgcgcttccgcacgctcgtccggcag
cagtcgcaggcgcaggccgccgccgccgcccagcagcagcagatcgcgcagcagactaac
gtgcccatcccggagcaccagcaaggctcctggaagcacgaggaccccaagcctcaggag
gcgagtgccgcgggcggccatacgaacgatctggaatcgtccttgcaacggggaatggac
gtgcaatga

DBGET integrated database retrieval system