KEGG   Aspergillus clavatus: ACLA_053300Help
Entry
ACLA_053300       CDS       T01148                                 

Definition
ergosterol biosynthesis ERG4/ERG24 family protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
act  Aspergillus clavatus
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    ACLA_053300
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     ACLA_053300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 319 aa AA seqDB search
MVLTHLLDFWAMLYHCLPGLINIGQHTPAGHLLTYRTNGLLAWVVTHAAFVIMCWLGLLD
PAFIPRNWEGLFATMNLCGIILSLPAYLKAYLMPTHLEDWKFSGCAFYDFYMGIELNPRI
GDYFDLKLYTNGRPGLIAWTLVDLSNIAYHYQTYHHFNPSLILITILHGIYVLDFFINEA
WYLRTIDIAHDHYGFYLAWGCLTWVPSMYTLQSQYVGLYSTSASPIFLILIFSLGLAGYI
FGWWGWSRHANYVGDLLLSFAMCALVHTTSLLVWFYVIFMVILLVHRCLRDEERGQAKYG
VFWLEYCRRVPWRLVPGIW
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggttttaacccatctccttgatttctgggcgatgctataccactgcctaccgggtctg
atcaatataggtcagcacaccccagccggtcatttactgacatatcggacaaacggcctt
ctggcatgggtcgtaactcatgctgctttcgtcatcatgtgttggctgggtctcctagat
cccgctttcattccgcgtaactgggaaggactgtttgccaccatgaatctttgtggtatt
attctttctttgcccgcgtaccttaaggcatatctgatgcctacacatctggaagactgg
aagtttagtggctgcgctttctatgacttctatatgggcattgaactcaatccccggatt
ggggattacttcgacctcaagctttacaccaatggaagacctggcctgattgcatggaca
ctagtagacttgtcgaacattgcataccactatcagacataccaccactttaacccatct
ctaattctcatcacgattctccacggtatctatgtgcttgacttcttcatcaacgaagcc
tggtacctccgcacaattgacatcgcccacgaccactacggcttctacctcgcctggggc
tgcctcacctgggtcccttccatgtacaccttacaaagtcaatatgtcggcctctactcc
acttcagcctctccgatcttcctaatactcatcttcagcctgggtcttgcgggctacatc
ttcggctggtggggatggtcccgtcatgccaattatgttggggacttgctgctgagcttt
gccatgtgtgcgcttgttcacactacctcactcctggtctggttctatgtcatttttatg
gtgatcttactggtgcaccggtgcctccgggatgaagaaagagggcaggcaaaatatggg
gtattctggttggaatactgtcgaagagtgccctggcgacttgtgcctggaatctggtga

DBGET integrated database retrieval system