KEGG   Aspergillus clavatus: ACLA_054010Help
Entry
ACLA_054010       CDS       T01148                                 

Definition
TFIIH and nucleotide excision repair factor 3 complexes subunit (Tfb2), putative
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
act  Aspergillus clavatus
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:act00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    ACLA_054010
  Replication and repair
   03420 Nucleotide excision repair
    ACLA_054010
Transcription machinery [BR:act03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     ACLA_054010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 478 aa AA seqDB search
MAAAPSRPFDYLESLPGTVFIKLYQEPSTALAIFRRMLPDLAKCFVMALLYLKDPLPAAD
LETWVKPDSLKERDNALSTLGRLHILTNTMTADNVRAYMVTKEFASSLRQALTGAEHTQS
FGVVSNVSDEAAVSIADLDEYSRRQWEGVLGYMVGTGGLGMQRDVNLSKGVKQLLQAGHL
VEIRDRRVEITKDGFAFVLQDVGTQVWHILILYVESAEAIGMDSVEVLKFVFFLSSLELG
RSYEKKQMTSNQLRTLTDLADFGIVYQESPEATHFYPTRLATTLTSDSSALSNPIAGSLS
GPTGTASNKAGSGFIIIETNYRLYAYTSSPLQISLIALFTTLKYRFPNLITGKITRQSIR
RAVEMGITADQIISYLSTHAHPQMRKHNASRSTSNQAGMPVSVLPPTVVDQIRLWQLERD
RVKATPGFLFKDFVSLAEYEAPCRYAEEIGVLVWKSDRKRMFFVTRHEQVAAFLRSRK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggcaccatcccgtccgtttgattacctggagagcttgcctgggactgtgttc
atcaagctctatcaggagccatccactgctcttgcgatcttcaggcgcatgttgcctgac
ttggcaaaatgttttgtgatggcgcttctctacctcaaagatccgcttccagcagcggat
ctggaaacatgggtcaaaccggacagtctgaaggagcgtgataatgcgctgtccacgcta
ggccgactgcacattttgaccaacacaatgactgcggataacgtgcgagcgtacatggtc
accaaagagttcgcttcctcgctccgacaagctcttaccggcgccgagcatactcagtcg
tttggtgtggtgtccaatgtatccgatgaggcagcggtatcgatagccgatttagacgag
tactcgagacggcaatgggaaggggtcctaggatacatggtgggcacaggtggcttgggt
atgcaacgtgatgtcaatttgagcaagggcgtgaagcagcttttacaggccggccatctt
gtcgaaatcagggatcgtcgggtggaaatcaccaaggatggattcgcttttgtcctgcaa
gatgttggcacgcaagtgtggcatatcctcattctctatgttgagagtgcagaggccatc
ggcatggacagtgtcgaggttctcaaatttgtgttcttcctgagcagtcttgaacttggg
agatcctatgagaagaagcagatgacgtccaatcaactgcgcactctgaccgacctggcc
gactttggcattgtctaccaagaatcaccggaggccacacatttttatcccactcgtctc
gcgaccaccttgacctctgattccagtgctctgagcaatcccatcgccggttcactatct
gggcctacgggtacagcttcgaataaggcgggctctgggttcattatcatcgaaacgaat
taccgactgtacgcatacacctcctcgccgctccagatctctctcattgcactctttaca
accctgaaataccgcttccccaatttgatcacgggcaaaatcactcgccagtccatccgc
cgtgcagtcgagatgggtatcaccgctgatcagattatctcgtacctctcgacacatgca
cacccccagatgcgcaagcacaatgcatcccgatcgacttctaaccaagccgggatgccg
gtgtccgttctcccacccactgttgtcgaccagatccgcctctggcagctcgaaagagat
cgtgtcaaagcgacccctggattcttgttcaaggatttcgtcagtcttgcagaatacgag
gctccgtgtcggtatgccgaagaaatcggcgtcctggtttggaaatctgaccgcaaacga
atgttctttgtcacaaggcacgagcaagttgctgcattcttgagaagtagaaaatga

DBGET integrated database retrieval system