KEGG   Aspergillus clavatus: ACLA_055570Help
Entry
ACLA_055570       CDS       T01148                                 

Definition
profilin Pfy1, putative
Orthology
K05759  
profilin
Organism
act  Aspergillus clavatus
Brite
Exosome [BR:act04147]
 Exosomal proteins
  Proteins found in most exosomes
   ACLA_055570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 115 aa AA seqDB search
MGSGQFDKAAILSYDISDVEAQSPTFKISKEEIAGLKAAFASPGSAFQTGFTVGGDKFVA
IKADDRSLYGKKGKEGIVVVKAVSCVMVAHHGEAVQTTNAATVVENLVDYINNPR
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgggatccggccagttcgacaaggccgctattttgagctatgacatctccgacgttgag
gcccagtcccccaccttcaagatctcgaaggaggaaatcgccggcctgaaggctgctttc
gccagccccggcagcgctttccagaccggcttcactgtcggtggtgacaagttcgtcgct
atcaaggctgatgaccgcagtctctacggcaagaagggcaaggagggcatcgtcgtcgtc
aaggccgtttcttgcgtcatggtcgctcaccacggcgaggccgtccagaccaccaatgct
gcaaccgtcgtcgagaacctcgttgactacatcaacaacccccggtga

DBGET integrated database retrieval system