KEGG   Aspergillus clavatus: ACLA_055840Help
Entry
ACLA_055840       CDS       T01148                                 

Definition
(RefSeq) O-methyltransferase, putative
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
act  Aspergillus clavatus
Pathway
act00350  Tyrosine metabolism
act01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    ACLA_055840
Enzymes [BR:act01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     ACLA_055840
Exosome [BR:act04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ACLA_055840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_24 Methyltransf_3
Motif
Other DBs
NCBI-GeneID: 4707148
NCBI-ProteinID: XP_001274962
UniProt: A1C9L2
AA seq 285 aa AA seqDB search
MTKEEFDPSKAYAPQEQGTGFFDDGREIALLHFVYLHPDLENIRGSPEKVLAAIDEYGRT
KKYLMNVGEDKGRIVCDLIAEVQPKTMANGSVQVELGGYVGYSCILFGNAVRKAGGERYY
SLEMNPEFAAVIMSLVDLAGLSDVVKVVVGSSDASLARLHSDGLLQHIDLLFLDHYKPAY
TTDLKLCEELKLITPGSVLAADNVIKPGNPPYLEYVRSSVEEKRKKLGADGSSEGIPGHT
VNQYQKRYGEMKFNQSPGNPNLVYESKLVNSFEPTGLPVSISLTV
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggaggaatttgatccgtccaaggcctatgcgccgcaggagcagggaacgggc
ttcttcgacgacggtcgcgagatcgcgcttctgcactttgtgtatttgcatcctgacctg
gagaatattcggggctcgccggagaaggtgctcgcagccattgatgagtatggtcggacg
aagaagtatctgatgaatgtcggcgaggacaagggccggattgtctgcgatctcatcgcg
gaggtccagccgaagaccatggctaacggtagtgtgcaggttgagctgggaggctatgtt
ggctactcgtgtatcttgtttggcaatgccgtgcggaaagcgggaggcgaacgctactac
agcctggagatgaaccccgagttcgcggcggtgatcatgtcgctggtcgacctggctggc
ctctcggacgtcgtgaaagtggtcgtcggctccagcgatgcttccctggcgcgtctccac
tccgacggcctgctccagcatatcgatctcttgttcctggaccactacaaaccagcatac
acgaccgatctcaaactctgcgaagagctgaagctgatcaccccgggctccgtcctcgct
gctgacaacgtcatcaagccgggaaacccaccgtacctggagtatgtccggagcagcgtg
gaggagaagcggaagaagctgggagcggacgggagcagcgaggggattcccgggcatacg
gtgaaccaatatcaaaagaggtatggggagatgaaattcaaccagagtcctggcaatccg
aatctcgtgtacgagagcaagctggtgaacagctttgagccaactggcctgccggtaagc
atatccctgactgtatag

DBGET integrated database retrieval system