KEGG   Aspergillus clavatus: ACLA_055880Help
Entry
ACLA_055880       CDS       T01148                                 

Definition
Patatin-like serine hydrolase, putative
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
act  Aspergillus clavatus
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ACLA_055880
Enzymes [BR:act01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ACLA_055880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1419 aa AA seqDB search
MSLTFTMNFTTLLLILLAVVSTLGWFVRYRFLNMYSRLPPEPQRKEPQIDLFPDVQGGDS
KPGLANYLDEFLSAIKVFGYLERPVFHELTRTMQTRKLIAGETLMLEEEKGFCLVVDGLV
QIFVKSTRDGKSGSDDELHHLGAESSDEEHHIDGKQGYQLLTEVKNGASMSSLFSILSLF
TEDIQVWDSQSSTSSSSSIAMRAARVPDSTPNSPRGGMDSPTPIFRDVPDPVSLVNENGD
LPLVPPLHLEESPIPPTNHAHDRRQHDHRKHHGRKHRKSVHPDIVARAMVDTTIAIIPAS
AFRRLTRVYPRATAHIVQVILTRLQRVTFATAHSYLGLSNEVLGIEKQMTKFTTYDLPNN
MRGTALDRLKDKFIKERDRLGTEEVTKGIALHNPSAGRRRRSSSFMRKDAVLHAKMMSPK
RAATVITSDNSYDHDSAGVSPGDLLSTIQQSRFGPRYEQPTPRLRSPLAEKENSHFRLPA
MQARNAFHRKESLDEDALFRECILDCIMKAIGLTSSTGEVLRKSSHSGEASPKLLSYDSR
RQKAVFSNNAFGFIDPYEGSGDGETESMMSMSVTSAGGTSPVTSLREELRNDIEIVYFPQ
GSVLVEQGERHPGLYYVIDGFLDVGMPVVDKGEDLVGVSKPATAREPFPTLKRTTTASSI
KPSATAANDPRRRKQSRKSLYLIKPGGIQGYVGAVASYRSYTDVVAKTDVYVGFLPRASL
ERIAERYPIALLTLAKRLTSLLPRLLLHIDFALEWVQVNAGQVIYHQGDESDAIYLVLNG
RLRSVLESADNKLTVIGEYGQGESVGELEVMTESTRPATLHAIRDTELAKFPRSLFNSLA
QEHPGITIQVSKLIAQRMRDLVERPVTEKGAERSSAGGVQTATSTLNLRTVGILPVTAGV
PVVEFGNRLLHALHQIGVVNGVTSLNQSAILNHLGRHAFSKMGKLKLAQYLADLEEKYGM
VLYIADTNVNSPWTQTCITQADCILLVGLAESSPSIGEYERFLLGMKTTARKELVLLHSE
RYCPPGLTRRWLKNRVWINGGHHHIQMAFRLTAEPSHPETKRFGTVLKQRVQVLQAEIQK
YTSRRIRQTPLYSAQTPFKGDFHRLARRLCGRAVGLVLGGGGARGIAHVGVIKALEEAGI
PVDIIGGTSIGSFIGALYARDADVVPMYGRAKKFAGRMGSMWRFALDLTYPTISYTTGHE
FNRGIFKTFGDSQIEDFWLEFYCNTTNISKSRQEYHSSGYVWRYVRASMSLAGLIPPICD
EGSMLLDGGYIDNLTVDHMKGLGADVIFAVDVGSIDDNTPQGYGDSLSGFWVAFNRWNPF
SSCPNPPTLSEIQARLAYVSSIDNLERAKITPGCLYMRPPIDAYGTLEFGKFDEIYQVGY
KFGKQFLEKLKNEGSLPLPEETEEEKKLLRTMAPRRASI
NT seq 4260 nt NT seq  +upstreamnt  +downstreamnt
atgagcctaacgttcacaatgaacttcacgaccctcttgttgatcctcctggcggtggtt
tcgaccctcggctggttcgtccggtaccgcttcctgaacatgtacagtcgactgcctccc
gagccccagcgcaaggaacctcagatcgacctcttccccgatgtacaaggaggagactcg
aagccgggactggccaattacctcgatgagttccttagtgctatcaaggtctttggctac
ctggagcggcccgtctttcacgaattgacgcggacaatgcaaacgcggaagctgatcgcg
ggcgagacgttgatgctggaggaagagaagggattctgtctggtggtggacgggttggtg
cagatctttgtcaagtccaccagggacgggaagtcaggcagcgatgatgagctgcaccac
cttggggccgaatcctcggacgaggaacaccacattgacgggaagcaggggtatcaattg
ctcactgaggtcaagaatggcgcatccatgtcgtctctgttctccattctttcgctcttc
accgaagacatccaggtgtgggactcgcaaagttcgacctccagctcctctagcattgct
atgcgcgccgcccgcgtgccagattcgaccccaaacagccctaggggtggcatggacagt
cccacgccaatttttcgcgatgttcccgaccccgtttcgcttgtaaatgagaatggggac
ctgccactggtacctccgctccatctggaagaaagtccgatccctcccaccaatcatgcc
catgaccgtcgccagcacgatcatcggaagcatcatggcagaaaacatcggaagtccgtc
cacccggatattgtcgcccgggcgatggtagatacgaccattgccatcatccccgccagt
gctttcagacgcctaacccgggtctaccccagagcaactgcacatatcgtccaagttatt
ttaactcgtcttcagcgggttacctttgccacggcgcattcatatctcggcctcagtaac
gaagtgctgggcattgaaaaacaaatgaccaagttcacgacctatgatctgccgaacaac
atgcgtgggaccgctctggatcgtcttaaggataagttcatcaaggaacgggaccgattg
ggtaccgaagaagtcaccaaagggattgcgctgcacaacccgtctgccggccggaggcgc
cggtctagcagctttatgaggaaagatgccgtgctccacgccaagatgatgtcgccgaag
cgtgccgctaccgtcattacttcagacaattcatatgatcacgactcggccggagtcagc
cccggagatctcctgtccacaattcagcagtcgaggtttggccctaggtatgagcagccg
accccccggcttcggtcccccttggccgagaaagaaaattcccacttccggcttcccgcc
atgcaggcccggaacgcgttccaccgaaaagagtctctggacgaggatgcgctattccga
gaatgcatattggattgcatcatgaaggcaatcgggctcaccagtagcaccggagaggtg
ttgcgtaagagcagccactctggcgaagcgtccccaaagctcctgtcctatgattcccgg
cgccagaaagcggtcttctcgaacaatgcctttggctttattgatccctacgaaggttcc
ggcgacggcgaaacggagtcgatgatgtccatgtctgttacaagtgcaggaggcacctcg
cctgttacaagcctacgggaagagctgcggaacgatattgaaattgtctatttcccgcaa
ggttcagtcctagtggagcaaggagaacgccatccggggctgtactacgtgattgacggg
ttcttggacgtgggcatgccagtcgttgacaagggagaagacctcgttggcgtttccaaa
ccggcgaccgcacgcgaacctttcccaaccctgaagcgcacgacaactgcatcctccatt
aagcccagcgccactgccgcgaacgatcctcgccggagaaagcagtcccgcaaatcgctg
tatctgatcaaaccaggtggaatccaaggctatgtcggagctgtggcgtcctatcgatcg
tataccgacgtcgttgccaaaacagacgtctatgtgggcttccttccacgggcgtccttg
gagcggatcgcagagcgttaccccattgctttgctgactctggcgaagaggctgaccagt
ctccttccccgcttgctcctccacattgattttgctctcgagtgggtccaggtaaatgca
ggacaggttatctaccaccaaggtgacgagagtgatgcgatctaccttgtactgaatggg
cggctgcgatcagtcctggaaagcgcggataacaagttgacggtgattggcgaatatggc
cagggagaaagtgtaggcgagctcgaagtgatgaccgagtccactcgtccagcgactctg
catgcaattcgcgataccgaattggcgaagttcccacggtctcttttcaacagtcttgcg
caggagcatcccggaatcacgatccaggtttccaagctgatcgcgcaacggatgcgggac
ctggtcgaacggccggtgacggaaaagggagctgagcgcagcagcgctggtggcgtccag
actgcaacctcgaccctgaatctccgcactgtcggtattctccccgtgacggcgggtgtt
ccagtggtggagttcggtaaccggttgttgcacgctctgcatcagattggggtggtcaac
ggggtcacttctctcaaccagtccgctatcctgaatcacctggggcgccatgcgttcagc
aagatgggtaagctcaaactggcccagtatctagcggatctggaagagaagtatgggatg
gttctgtacattgcggacacgaatgtgaactctccctggacgcaaacctgcattacgcag
gcggattgtattcttttggtgggcctggcggaatcgtcgcctagtatcggcgagtatgag
agattcctccttggcatgaagactacagcccggaaggagcttgtgctgcttcactcggag
cgctattgcccaccgggcctgacacgacggtggttgaagaaccgggtgtggatcaacggc
ggccatcaccatatccaaatggcatttcgattaacagcggagccttcgcacccagagacc
aagcgcttcggcaccgttctcaaacagcgagtccaggttctccaggcggagatccagaag
tacacctcgcgaaggattcgtcagacaccgctctactccgcccaaaccccgttcaagggc
gatttccaccgcctcgcacgtcgcctgtgtggcagagctgttggtcttgtacttggtggt
ggcggcgcgagaggtatcgctcacgtcggcgtgatcaaggcgcttgaggaggctggtatt
cctgtcgacattatcggcggtacctcaatcgggtcgttcatcggcgcgctgtatgctcgc
gatgcggatgtggttcccatgtacggtcgggcgaagaagttcgctggacggatgggcagc
atgtggcggttcgcgctggatctgacatatccgaccatttcatacaccaccgggcacgag
ttcaaccggggcatcttcaagacgtttggtgatagtcaaatcgaggatttctggctggag
ttctactgcaacacgaccaatattagcaagtcgcgccaggagtatcattcgtccggctac
gtctggcgttacgtgcgggcatccatgtcgctagcgggcctgatcccgcccatctgcgat
gaaggtagtatgctactggacggtggctacattgacaatttgaccgtcgaccacatgaag
ggtctcggtgcggacgtgattttcgcagtggacgtgggctctatcgatgacaacactccc
caggggtatggcgactcgctttccggcttttgggtggccttcaaccgctggaatccgttc
tcgtcgtgtcccaatccgccaaccctatctgaaatccaagcacggctggcatacgtctca
tccattgataacttggaacgcgccaagatcaccccgggctgcctgtacatgcgtcctccc
attgatgcctacggcacgctggagttcggcaagttcgacgagatctaccaggtcggctac
aaattcggcaagcagttcctcgagaagctgaagaacgaagggtccctgccgctgccggag
gagacggaggaggagaagaagctgctgcggacgatggcaccccggcgagccagtatttga

DBGET integrated database retrieval system