KEGG   Aspergillus clavatus: ACLA_057390Help
Entry
ACLA_057390       CDS       T01148                                 

Definition
beta-N-acetylglucosaminidase, putative
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
act  Aspergillus clavatus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ACLA_057390
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    ACLA_057390
Enzymes [BR:act01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ACLA_057390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 931 aa AA seqDB search
MAPKEDMLPPGWEDLDRQMGQLFMMGFDGTSVNPEIRSLIENYHLGSVLLTAKNLKSAEE
ATRLVLELQTIARDAGHRVPLLIALDQENGGVNSLYDEIYIRQFPSAMGIAATGSKALAH
DVAFATAQELKAVGVNWILGPVLDVLTNVRKQPLGVRTSGDDPQEVSQYGVEFMKGYQEA
GLVTCGKHFPSYGNLEFLGSQTDVPIITESLEQLSLTALVPFRNAIIHGLDSMMVGGVSM
SSAGVNVMHACLSEQVVDDLLRKDLKFNGVVVSECLEMEALTHNIGVGGGTVMAKNAGCD
IILLCRSFPVQQEAINGLKVGVENGILGRARIEQSLRRVLAMKARCTSWEQALNPPGLSS
LTQMQPSHTSLSKRAYNSSISVIRDKQNLLPLSNIIEPNEELLLLTPLVKPLPASAVSRS
VTEHVNPSLDPIAWDRTASVLSGESVFKELGRSLSRQRSGRVLHTSYTANGVRPIHENLI
DRASAVIIVTADANRNMYQHGFTKHVSLICRSQFTPSGEPREKPVIVVAASSPYDFAMDP
TIGTYICTYDFTETALEALVKVLYGELTPKGSLPGSISRSQKLHQARQHWLVESWNEERD
AEALDALLDAVRDNCAQGQRSELLGASSSSFLLRREEIDEAHFVVRNSSTQALYGFCSTY
FFRSTGTGVIGSLIVDPARRKLSIGTSLHNRAIRTLLQRKGMRRFQLGSRLPGIFLGVPS
SNSVERKRLRQWFANLGWNTALSRPVCSVVLRNLSTWAPPDGLIQAVKNTDVAYDLVYGW
DYAEPVLDHVRTHSRQGLIDIYKIALGGAPNCGIIRATRPDDGAILGTVVIYNGRAPLAE
YMPALRATRTLTGGISSPVISPSVGEYATVMQGLVLLGIKQIRKQGADAVLMDCVDGDSN
FDCLSGMGFSMLHSFEEVNCDATTWTLMPAS
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggccccgaaagaggacatgctgccccctggttgggaggatttagacaggcagatgggg
cagctcttcatgatgggctttgacggaacttcggtcaatcctgaaatccgttctctgatc
gagaattaccacctgggctcggttttgttgaccgctaaaaacttgaaatctgcagaagag
gcaacgcgcttagtcctggagctccaaacaattgcccgagatgccggccatcgagttcct
cttctgatcgccctagaccaggaaaatggcggcgtgaacagcttgtacgatgaaatctac
attcgccagtttcctagtgcaatgggcatcgcagcgactggatccaaggcattggctcat
gatgtcgcgttcgctaccgctcaagagctcaaggctgttggagtcaattggatccttggc
cccgttctggatgtgttgaccaacgtacgaaagcagcctctgggtgtccgaactagtggc
gacgatccccaggaggtgtcgcaatatggcgttgaattcatgaagggttaccaggaagca
gggctggtcacatgtggcaagcactttccctcttacggcaatctggaatttctgggttct
cagacggacgtcccgatcatcaccgagtcactagaacagctcagcttgaccgcattggtc
ccgttccgaaatgccatcatccacggtttagattcaatgatggtcggaggcgtctccatg
tcatctgcgggcgtaaatgtcatgcacgcttgtttgagtgaacaagttgttgacgatttg
ttgcggaaagacctgaagttcaacggggtagtcgtttcagaatgcctcgaaatggaggcg
cttacacacaatatcggagttggcgggggaacagtaatggcaaagaacgcaggatgtgat
atcattctcttgtgcagatccttcccagtgcagcaggaggccatcaatggactgaaagta
ggagttgaaaatggcatcctgggccgagctcgaatagagcaatcgctgcgcagggtcttg
gccatgaaggcgagatgcacctcttgggaacaggctctgaatcctccgggtctgtcgtct
ctcacacaaatgcagccatcccatactagcttgtccaagagggcatataacagttcgatt
tctgttatacgtgacaagcagaatcttcttccgctctccaacattatcgagcccaacgag
gagctgctgctgttgactcctctggtgaagccgttacccgcgtccgcagtatctcgatca
gtgaccgagcatgtcaatccttcccttgacccaatcgcttgggatcgaaccgcgtctgtt
ctgagtggggaaagtgtgttcaaggaactgggtcgatctctctcgcgtcagagaagtggg
cgagtcctacatacctcttatacggctaacggtgttcggcctatccacgagaacctaata
gaccgtgctagtgccgtcatcatcgtcacggcagatgcgaaccggaatatgtatcagcac
gggtttacgaaacatgtatccttgatatgtaggtctcaattcactccgtccggtgagcct
cgagaaaagccggtgattgtcgtggctgctagttctccttacgactttgccatggatccg
accattgggacttatatctgcacatatgatttcacagagactgccttggaggcgttggtc
aaagtcctgtatggagaacttacccccaaaggctcattgccgggttctattagccgcagc
cagaagcttcaccaagcacggcagcactggctcgtggagagctggaatgaggaacgagac
gcagaagctttggacgctttgcttgacgcagtcagagataattgtgcgcaaggtcagcgc
tccgagttgttgggtgcgtcatccagcagcttcttgctgcgaagagaagaaatcgacgag
gcacatttcgttgtccggaacagtagtacacaagctttatatggattctgctcgacctat
ttcttcaggtctaccggtactggcgttattgggtctctgattgtggatcctgcaagacgg
aaattgtcaattgggacttccttgcataatcgtgcaattcgaacgctcctgcagcgaaag
ggcatgcggcgattccaattgggatcgcgtcttccaggtatatttctgggcgtcccgtca
tccaattcggtcgaacgaaaaaggttacgacagtggttcgcgaatttaggctggaacact
gccctttcgcgacccgtttgtagtgttgtgctacgcaatctatcaacatgggcaccgccg
gacggtcttattcaagcagtgaagaatacggatgtggcctatgacctggtttacgggtgg
gattatgctgaacctgtcctagatcatgtcagaacccattcccgacagggactgatcgac
atctacaagattgccttggggggagcacccaactgcgggatcatcagagcaacgcgtcca
gatgatggggcaatcctgggtaccgtggtcatatataatggacgggcccccttagccgaa
tatatgcctgccctgagagccacacgtaccttgactggaggtatatcgtcgccggtcatc
tcgccatccgttggagagtatgctaccgtgatgcagggcctggttcttttgggtatcaaa
cagatccgtaaacaaggtgcagatgcggtactcatggactgcgtcgatggcgacagtaac
ttcgattgtctttccgggatggggttcagtatgcttcatagttttgaagaagtcaactgt
gatgcgacgacttggaccctgatgccagcatcgtag

DBGET integrated database retrieval system