KEGG   Aspergillus clavatus: ACLA_057390Help
Entry
ACLA_057390       CDS       T01148                                 

Definition
beta-N-acetylglucosaminidase, putative
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
act  Aspergillus clavatus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:act00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:act00312]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 931 aa AA seqDB search
MAPKEDMLPPGWEDLDRQMGQLFMMGFDGTSVNPEIRSLIENYHLGSVLLTAKNLKSAEE
ATRLVLELQTIARDAGHRVPLLIALDQENGGVNSLYDEIYIRQFPSAMGIAATGSKALAH
DVAFATAQELKAVGVNWILGPVLDVLTNVRKQPLGVRTSGDDPQEVSQYGVEFMKGYQEA
GLVTCGKHFPSYGNLEFLGSQTDVPIITESLEQLSLTALVPFRNAIIHGLDSMMVGGVSM
SSAGVNVMHACLSEQVVDDLLRKDLKFNGVVVSECLEMEALTHNIGVGGGTVMAKNAGCD
IILLCRSFPVQQEAINGLKVGVENGILGRARIEQSLRRVLAMKARCTSWEQALNPPGLSS
LTQMQPSHTSLSKRAYNSSISVIRDKQNLLPLSNIIEPNEELLLLTPLVKPLPASAVSRS
VTEHVNPSLDPIAWDRTASVLSGESVFKELGRSLSRQRSGRVLHTSYTANGVRPIHENLI
DRASAVIIVTADANRNMYQHGFTKHVSLICRSQFTPSGEPREKPVIVVAASSPYDFAMDP
TIGTYICTYDFTETALEALVKVLYGELTPKGSLPGSISRSQKLHQARQHWLVESWNEERD
AEALDALLDAVRDNCAQGQRSELLGASSSSFLLRREEIDEAHFVVRNSSTQALYGFCSTY
FFRSTGTGVIGSLIVDPARRKLSIGTSLHNRAIRTLLQRKGMRRFQLGSRLPGIFLGVPS
SNSVERKRLRQWFANLGWNTALSRPVCSVVLRNLSTWAPPDGLIQAVKNTDVAYDLVYGW
DYAEPVLDHVRTHSRQGLIDIYKIALGGAPNCGIIRATRPDDGAILGTVVIYNGRAPLAE
YMPALRATRTLTGGISSPVISPSVGEYATVMQGLVLLGIKQIRKQGADAVLMDCVDGDSN
FDCLSGMGFSMLHSFEEVNCDATTWTLMPAS
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggccccgaaagaggacatgctgccccctggttgggaggatttagacaggcagatgggg
cagctcttcatgatgggctttgacggaacttcggtcaatcctgaaatccgttctctgatc
gagaattaccacctgggctcggttttgttgaccgctaaaaacttgaaatctgcagaagag
gcaacgcgcttagtcctggagctccaaacaattgcccgagatgccggccatcgagttcct
cttctgatcgccctagaccaggaaaatggcggcgtgaacagcttgtacgatgaaatctac
attcgccagtttcctagtgcaatgggcatcgcagcgactggatccaaggcattggctcat
gatgtcgcgttcgctaccgctcaagagctcaaggctgttggagtcaattggatccttggc
cccgttctggatgtgttgaccaacgtacgaaagcagcctctgggtgtccgaactagtggc
gacgatccccaggaggtgtcgcaatatggcgttgaattcatgaagggttaccaggaagca
gggctggtcacatgtggcaagcactttccctcttacggcaatctggaatttctgggttct
cagacggacgtcccgatcatcaccgagtcactagaacagctcagcttgaccgcattggtc
ccgttccgaaatgccatcatccacggtttagattcaatgatggtcggaggcgtctccatg
tcatctgcgggcgtaaatgtcatgcacgcttgtttgagtgaacaagttgttgacgatttg
ttgcggaaagacctgaagttcaacggggtagtcgtttcagaatgcctcgaaatggaggcg
cttacacacaatatcggagttggcgggggaacagtaatggcaaagaacgcaggatgtgat
atcattctcttgtgcagatccttcccagtgcagcaggaggccatcaatggactgaaagta
ggagttgaaaatggcatcctgggccgagctcgaatagagcaatcgctgcgcagggtcttg
gccatgaaggcgagatgcacctcttgggaacaggctctgaatcctccgggtctgtcgtct
ctcacacaaatgcagccatcccatactagcttgtccaagagggcatataacagttcgatt
tctgttatacgtgacaagcagaatcttcttccgctctccaacattatcgagcccaacgag
gagctgctgctgttgactcctctggtgaagccgttacccgcgtccgcagtatctcgatca
gtgaccgagcatgtcaatccttcccttgacccaatcgcttgggatcgaaccgcgtctgtt
ctgagtggggaaagtgtgttcaaggaactgggtcgatctctctcgcgtcagagaagtggg
cgagtcctacatacctcttatacggctaacggtgttcggcctatccacgagaacctaata
gaccgtgctagtgccgtcatcatcgtcacggcagatgcgaaccggaatatgtatcagcac
gggtttacgaaacatgtatccttgatatgtaggtctcaattcactccgtccggtgagcct
cgagaaaagccggtgattgtcgtggctgctagttctccttacgactttgccatggatccg
accattgggacttatatctgcacatatgatttcacagagactgccttggaggcgttggtc
aaagtcctgtatggagaacttacccccaaaggctcattgccgggttctattagccgcagc
cagaagcttcaccaagcacggcagcactggctcgtggagagctggaatgaggaacgagac
gcagaagctttggacgctttgcttgacgcagtcagagataattgtgcgcaaggtcagcgc
tccgagttgttgggtgcgtcatccagcagcttcttgctgcgaagagaagaaatcgacgag
gcacatttcgttgtccggaacagtagtacacaagctttatatggattctgctcgacctat
ttcttcaggtctaccggtactggcgttattgggtctctgattgtggatcctgcaagacgg
aaattgtcaattgggacttccttgcataatcgtgcaattcgaacgctcctgcagcgaaag
ggcatgcggcgattccaattgggatcgcgtcttccaggtatatttctgggcgtcccgtca
tccaattcggtcgaacgaaaaaggttacgacagtggttcgcgaatttaggctggaacact
gccctttcgcgacccgtttgtagtgttgtgctacgcaatctatcaacatgggcaccgccg
gacggtcttattcaagcagtgaagaatacggatgtggcctatgacctggtttacgggtgg
gattatgctgaacctgtcctagatcatgtcagaacccattcccgacagggactgatcgac
atctacaagattgccttggggggagcacccaactgcgggatcatcagagcaacgcgtcca
gatgatggggcaatcctgggtaccgtggtcatatataatggacgggcccccttagccgaa
tatatgcctgccctgagagccacacgtaccttgactggaggtatatcgtcgccggtcatc
tcgccatccgttggagagtatgctaccgtgatgcagggcctggttcttttgggtatcaaa
cagatccgtaaacaaggtgcagatgcggtactcatggactgcgtcgatggcgacagtaac
ttcgattgtctttccgggatggggttcagtatgcttcatagttttgaagaagtcaactgt
gatgcgacgacttggaccctgatgccagcatcgtag

DBGET integrated database retrieval system