KEGG   Aspergillus clavatus: ACLA_057860Help
Entry
ACLA_057860       CDS       T01148                                 

Definition
mannosyltransferase PMTI
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
act  Aspergillus clavatus
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    ACLA_057860
Enzymes [BR:act01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     ACLA_057860
Glycosyltransferases [BR:act01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   ACLA_057860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 781 aa AA seqDB search
MSQSPSSSLRKRGGKKETYPPVPTDDVSSSPLSSPKLPVASKSQSEWDYRLALVVLTVLA
FITRFYKISYPNEVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFALMGWLVGYDGHFL
FDNIGDSYIDNKVPYVALRAMPATLGALTIPVVFLIMWESGYSLPACVLAAGLVLFDNAH
VGEDRLILLDASLVLTMALSILCYVRFYKLRHEPFGRKWWKWLLLTGVCLSCVISTKYVG
VFTFVTIGAAVLVDLWNLLDINRPSGSLSMVHWGKHFAARAFALIIVPIFFYLFWFQVHF
AILTRSGPGDDFMTPEFQETLSDNAMAAQSVGIEYFDTITIRHKDTKVLLHSHWEKYPLR
YDDGRISSQGQQVTGYPFNDTNNNWQILPAVPLPGVDDKGHSVKNGDIIQLRHVGTDTVL
LTHDVASPYYPTNQEFTTVSHELANGERHNDTLFEIKIENGKAQQEFRTLSSHFKLIHVP
TRVAMWTHTNPLPEWAFKQAEINGNKNVLQSSNLWFVESIESLDESNPRASKEVRQVKHL
PFWRKYLELQRAMFFHNNALTSSHPYASEPFQWPFLLRGVSFWTKNDTREQIYFLGNPIG
WWIASSLLAVFAGVIGADQLSLRRGVDALEEIWGRGSRSRLYNSTAFLFLCWAAHYFPFW
LMGRQRFLHHYLPAHVASAMVTGALIEFIFNLQPISVPRPVKEDDPTGKSKAEASPGHFV
TAKERMGRQSLIAAWVATLVILSVTIWGFCFYAPLTYGTPGLDVAGVNSRKWLGYDLHFA
K
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaatctccttcgtcctctcttcgtaagagaggggggaagaaggagacctacccc
cccgtcccaacggacgatgtctcctcctctcctttgtcttcgccaaagttgcccgtcgct
tccaaaagccagtcggaatgggactataggctggccttagtcgtcctcaccgtcctggcg
tttatcactcgattctacaagatatcctaccctaatgaggtcgtgttcgacgaggtgcat
tttggcaagtttgcttcttactacctacaacggacttatttcttcgatgtgcaccccccg
ttcggcaagctcctcttcgcgttgatggggtggctggttggttacgacggccacttcttg
tttgataacattggcgactcttacatcgacaacaaagtcccttacgttgctctccgcgcc
atgcccgccacccttggcgctctgaccattcccgtcgtgttcctcatcatgtgggagtcc
ggatattccctcccagcgtgtgtgttggccgctggccttgtgctgtttgataatgcccat
gtcggagaggaccggttgattctgctcgatgctagcttggtgcttacgatggccctgagc
atcctgtgctacgtccgcttctataagctgcgccatgagccctttggacggaagtggtgg
aagtggctgctcttgaccggtgtttgtctcagctgcgtcatctctacgaaatatgtcggc
gtcttcacgtttgtcacgatcggtgctgcggtcctggttgacctgtggaacttgttggat
atcaaccgcccttcgggatctctcagcatggttcattgggggaagcattttgccgctcgc
gcttttgccctcatcattgtgcctatctttttctacctgttttggttccaggtccacttt
gccattctcacgcgctccggacccggtgatgattttatgaccccagagttccaggaaacc
ctgagtgacaacgcaatggcagcacagtccgtcggcatcgagtacttcgacacgatcacg
atcaggcacaaggataccaaggtgctgctacacagccactgggagaagtatccgctgcgc
tacgacgatggacgtatttccagtcagggccagcaggtcaccggatatccgttcaacgat
accaacaacaactggcagattttgcctgccgtccctcttcctggtgtcgacgacaagggt
cacagcgtcaagaacggcgacattattcaactccgccacgttggtaccgataccgttctc
ctgacccacgatgttgcgtctccctactaccccaccaaccaagaattcaccaccgtctct
cacgagttggccaatggcgagcgtcacaacgacacgctcttcgagatcaagatcgagaat
ggcaaggctcaacaggaattccgcactctttcaagccatttcaaactcatccatgtcccc
actcgggtggctatgtggactcacacgaacccgctgccggagtgggccttcaagcaggct
gagatcaacggcaacaagaacgttcttcagtccagcaacctttggtttgtcgagtctatt
gagtcgctggatgagagcaaccctcgggcttccaaggaggtgcgccaggtcaagcatctg
cccttctggcgcaagtaccttgagctgcaacgcgccatgttcttccacaacaacgccctg
accagcagccacccgtacgccagcgagcctttccagtggcccttccttcttcgtggtgtc
agcttctggaccaagaacgacactcgggagcaaatttatttccttggtaatccaattgga
tggtggattgccagcagtctgttggctgtgtttgccggtgtcattggcgctgaccagttg
tctcttcgacgtggagtcgatgcccttgaagaaatttggggccggggttctcgttcgcgc
ctgtacaacagcacagccttcttgttcctttgctgggccgcccactatttccccttctgg
ttgatgggtcgtcagcgtttcctccaccattacctgccggctcatgttgcctctgccatg
gtgaccggtgctctgatcgagttcatcttcaacctgcagccgatctcggttcctcgccct
gtcaaggaggatgaccccacgggcaagtccaaggcggaggctagccccggccacttcgtc
acggcgaaggagcgcatgggtcgccagtcgctcattgcggcgtgggttgccaccctggtc
attctgagcgtgaccatctggggcttctgcttctacgcgcccttgacctacggtactcct
ggtctggacgttgcgggcgtgaattcgcggaagtggctgggctatgacctgcattttgcc
aaataa

DBGET integrated database retrieval system