KEGG   Aspergillus clavatus: ACLA_058420Help
Entry
ACLA_058420       CDS       T01148                                 

Definition
beta-N-acetylhexosaminidase NagA, putative
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
act  Aspergillus clavatus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ACLA_058420
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    ACLA_058420
   00603 Glycosphingolipid biosynthesis - globo series
    ACLA_058420
   00604 Glycosphingolipid biosynthesis - ganglio series
    ACLA_058420
   00511 Other glycan degradation
    ACLA_058420
Enzymes [BR:act01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ACLA_058420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 602 aa AA seqDB search
MLISSICVVVLTVASSVTAVSVNPLPAPRKITWGSSGPQYVAGQLSLRTGRDGHDFTISQ
GWNRAWGSIVTLKWVPAATEAPISSFEPFPTEAPSSSGKSKRGRPSSLRFVDVQVEDHKA
DLQHGVDESYTLDVVDGSDSIRITAKTVWGALHAFTTLQQIIISDGRGGLLIEQPVRIQD
APLYPYRGIMIDSARNFISVRKILEQLDGMALSKLNVLHWHLDDTQSWPIHIDAYPQMTK
DAYSKREIYSHADLRRVIAYARARAIRVIPEVDMPSHSASGWQQVDPEMVTCTDSWWSND
DWAFHTAVEPNPGQLDIIYEGTYEVVKNVYNELSSIFTDNWFHVGADEIQPNCYNFSSHV
REWFAEDPSRTNNDLLQYWIDRAVPMFREVSEKRRLIMWEDVVTSTEHAHDVPKDIVMQS
WNNGLEYIKQLTSKGYDVIVSSSDFFYLDCGYGGFVSNDPRYNVMVNPDPNTPNFNFGGN
GGSWCGPYKSWQRIYNYDFTQNLTDAEAKHVIGVTAPLWAEQVDDTVISTKFWPRAAALA
ELSWSGNRDENGKKRTTLMTQRILNFREYLVANGVEAAPLMPKYCLQHPHACDLERNQNA
IQ
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgctcatctccagcatctgcgtcgtggtcttgacggtcgcctcgtccgtcaccgcggtc
agtgttaatcccctgcctgctcctcgcaagatcacatggggctcgtcaggcccacagtac
gtcgctgggcagttgagtctgcgtaccggtcgcgatggccatgatttcacaatttcccag
ggatggaaccgtgcctgggggtccatcgtcacgctgaaatgggttcctgctgcgactgaa
gctcctatttcctccttcgagcctttccccacggaggcgccttcatcgtccgggaagagc
aaacgcggccgcccgtcttcgctgcggtttgtcgatgtccaggtcgaggatcacaaagcg
gatctccagcacggcgtggacgagtcgtacactttggatgtggtagacggctcggatagc
attaggatcactgccaaaaccgtctggggagctctgcatgccttcaccactctgcagcag
attattatctcggacggacgcggaggcttgctcatcgagcagcccgtccgtatccaggat
gcgcctctctacccgtatcgcggcatcatgattgattccgctcgaaacttcatctccgtg
cggaagatcttggagcagctggacggcatggcgctgtcgaaactgaatgtcctgcactgg
catctggatgacacgcaatcgtggccgatccatatcgatgcctacccgcagatgaccaaa
gatgcgtactcaaagcgggagatttactcgcacgctgaccttcggcgcgttattgcgtat
gcccgtgctcgagccattcgcgttatccccgaagttgacatgccgagccattcggcatct
ggttggcagcaggtcgatccggagatggtgacgtgcaccgactcgtggtggtcgaacgac
gactgggcattccacactgcggttgagcctaacccgggccagctggacatcatctatgaa
gggacatacgaggttgtcaagaacgtatacaatgagctctcgagcatcttcacggacaat
tggttccacgtcggagcggatgagatccagcccaactgttacaacttcagcagccacgtg
cgggagtggtttgcagaggacccttcgcgcaccaacaatgatctgctgcagtactggatt
gaccgcgcagtccccatgttccgcgaggtcagcgaaaagcgccgtctcatcatgtgggag
gatgtcgtcacgtccaccgagcatgcccacgacgtgccgaaggacattgtgatgcagagc
tggaacaacggcctcgaatatatcaagcaactaacatccaaaggctacgatgttatcgta
tcgtcctccgatttcttctacctggactgtggctatggcggcttcgtctccaacgatccc
cgatacaacgtgatggtcaacccggatcccaacactcccaacttcaacttcggcggcaat
ggaggctcctggtgcggtccttacaagtcgtggcagcgcatctacaactacgacttcacg
caaaacttgaccgacgccgaagccaagcacgttatcggagtgaccgcgcccttgtgggcc
gagcaagtcgacgatacggtcatctcgaccaagttctggcctcgcgccgcggctctggcg
gagctgtcctggtccggcaatcgcgatgaaaacggcaagaagcgcacgactctcatgacc
cagcgcatcttgaacttcagagagtacctggtggcgaacggcgtcgaggccgctccgctc
atgcccaagtactgtctccagcatccgcatgcgtgtgacctggaacgcaaccagaatgcc
atccagtga

DBGET integrated database retrieval system