KEGG   Aspergillus clavatus: ACLA_060250Help
Entry
ACLA_060250       CDS       T01148                                 

Definition
beta-1,6-glucanase, putative
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
act  Aspergillus clavatus
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ACLA_060250
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ACLA_060250
Enzymes [BR:act01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     ACLA_060250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 488 aa AA seqDB search
MRTSGVLLSLAALSHAALEKRADSALAYSSNAAGNYKLSPVAAPVQGTGNPGGESTWQLS
VDDTSSGHKQTIVGFGAAVTDATVTSFNTLSSSTLQNLLNELMTSAGAGFALMRHTIGAS
DLSGDPAYTYDDNGGKEDPSLSGFNLGDRGTAMAQMLAKMKSLQPEMKVLGSPWSAPGWM
KLNGAIDGNTKNNNLNDGYLTSGGTGSTGYSSQFAQYFVKYIQAYETLGAHIDAITIQNE
PLNSQAGYPTMYVFDWESAQLIQNYIGPALANAGLNTEIWAYDHNTDVTSYPQTVINQAG
QYVNSVAWHCYASNVDWTVLSNFHSSNPGVKQYMTECWTPASGSWHQAADFTMGPLQNWA
AGVTAWTLGTDAQDGPHLSSGGCDSCRGLVTINNGGYTLNPAYYMMAQFSKFMPPGAIVL
NGSGSYTYSGSGGVQSVASLNPDGSRTVVIENTFNNDLYVTVTMKSGDKWSGNIPSESVT
TWVLPAAA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacatcaggcgtcttgctcagtctggcggctttgagccatgcagccttggagaaa
cgggcggattctgcacttgcctacagctccaacgcggcgggcaactacaagctctcccca
gtcgcagctccggtgcaagggacaggaaaccctggcggcgagtcaacttggcaattgtcc
gttgatgacacctcctctggacacaaacaaaccattgtcgggtttggtgcggccgtcacc
gatgccaccgtcacttcgttcaacaccttgtccagctccacactgcaaaacctgctcaat
gagttgatgacttctgccggcgcgggatttgccttgatgcgacacacaatcggcgcctca
gatttgtccggtgatccggcctatacgtacgacgacaatggaggcaaagaggatccatcg
ctgtcggggttcaacctgggcgaccgcgggacggccatggcccagatgctggccaagatg
aagtccctgcagccagaaatgaaggtgctcggctccccctggagcgccccgggatggatg
aagctgaacggagccatcgatgggaacacgaagaacaacaatttgaacgacggatatctc
accagcggcggtactgggagcacgggctattcgagtcagtttgctcagtactttgtcaag
tatatccaagcctatgagacactcggagcgcacatcgacgcgatcacgatccaaaatgaa
ccattgaatagccaagcgggttatcctaccatgtacgtctttgactgggagtcggcacag
ctcatccagaattacatcggcccggcccttgccaacgccggcttgaatacggagatctgg
gcatatgatcacaacaccgatgtgacctcgtatccccagactgtcatcaaccaggctgga
caatatgtcaattccgttgcctggcactgttatgcctcgaacgtggattggaccgttctg
agtaatttccactcgtccaaccctggagtgaagcagtatatgacagaatgctggacccca
gcatccggatcatggcatcaggcggccgatttcactatgggaccattgcagaattgggcc
gcaggagtgactgcatggactctcggtaccgacgcccaggatggtccgcatctgtccagt
ggtggttgtgatagttgccggggcctggttacgatcaacaatggcggatataccctgaac
cccgcatactacatgatggcgcagttcagcaagttcatgccacccggggcgatcgtgctg
aatggtagcgggagctacacatactccggcagcggcggcgtgcagtccgtcgcatccctg
aacccggacggctcgcgaacggtggtcattgaaaacacctttaacaacgacctctatgtg
accgtgaccatgaagagtggggataaatggagcgggaatattcccagcgagtcggtgacc
acctgggtactgcccgctgcggcctga

DBGET integrated database retrieval system