KEGG   Aspergillus clavatus: ACLA_060290Help
Entry
ACLA_060290       CDS       T01148                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
act  Aspergillus clavatus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACLA_060290
Enzymes [BR:act01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     ACLA_060290
Peptidases [BR:act01002]
 Cysteine Peptidases
  Family C44
   ACLA_060290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 263 aa AA seqDB search
MHTIVNGELYDHERHRAELSDRYDFNGQTDCEIAVALYKRYGLSCLSRHPATETKQFLAF
GLQPKWDVARLRDQRWLYGAYTYLKGVRTIMPGQYHLSKNFGSLGHYMYWDMDFPDKAVQ
AVKLRLGPDVLVGVHLRGGIDSWAIAGIAAQLVTEQGGKLGNDTTKELSRVKCFTGDFDK
ESEVDESGVYGSSLRGKPPDTMNPRFPMLNGTGKLAMADMASKRAITGDGPDEHFASCQL
LVLSPGIRTLFRGASLRRGEDTG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcacaccattgtgaacggggagttgtatgaccacgaacggcatcgtgcagaactgtct
gatcgatatgatttcaatgggcagactgattgtgagattgccgttgccttgtataagaga
tacggactgtcctgtctttcgcgacaccctgcgacagaaacgaaacagtttcttgccttt
ggtttgcagcccaagtgggatgtggctcggctgagagatcaaaggtggttatacggagca
tatacttatctgaagggtgttcgaacaattatgcctggtcaatatcacctgagcaagaat
tttggatctctgggacattacatgtactgggatatggatttcccagacaaggctgtacag
gctgtcaagcttcgccttggacctgatgtccttgtaggcgtccatctacgtggcgggata
gactcttgggcgatcgcaggaatcgccgctcagctggtcactgaacagggcgggaaactg
ggcaacgataccacgaaggaactctctcgagtgaagtgctttaccggggattttgacaag
gaaagtgaagtggatgaatctggagtctatggctcatcgcttcgaggaaagccgcctgac
acgatgaatccccgcttcccgatgttaaatggcacgggtaaactggccatggcagatatg
gcctcaaaacgggccattacgggagacggtccggacgagcactttgccagctgccagctc
cttgtgctatctccgggaatcagaaccttgtttaggggcgcctccctcagaagaggagag
gatacggggtag

DBGET integrated database retrieval system