KEGG   Aspergillus clavatus: ACLA_063650Help
Entry
ACLA_063650       CDS       T01148                                 

Definition
tyrosinase, putative
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
act  Aspergillus clavatus
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    ACLA_063650
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ACLA_063650
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     ACLA_063650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 383 aa AA seqDB search
MRLSIFSAVTALAAVTPTLGFNIDQWDLLAGKALVNQVVYHYTNPEASKTCTPLTAAIRR
EWGSLTRAERKEYINAVKCLASKPSKSDPAFAPGARNRYDDFVAVHINQTWVIHATGNFL
TWHRYFTWAYEQALRNECGYTGYQPYWAWNKYADDPLNSPIFDGSEYSMSGDGAYIPHEG
TEAAPGIVLKPGNGGGCVKAGPFKDWKVNLGPVFPSLKVPGVVAQNGSGLGYNPRCLRRD
ISKDAARWTTTNYVVDLITKENNILDFQNTMQGDFPNGFLGVHSGGHYTIGGDPGGDFFA
SPGDPAFFLHHSAIDRAFWTWQNQDPAKRTYVVEGPTVLPGLTPDPPNSTLNDIVDMSSA
LAPPKKIKELLDTTGGPFCYVYL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcggctctcaattttctctgcagttacagcattggctgctgtgacgcctactttgggc
ttcaacatcgatcaatgggatctgttggctggaaaggctctggtcaaccaggttgtctac
cactacacgaaccccgaagccagcaagacatgcacccctcttactgctgcaattcgaaga
gaatggggctcgcttaccagagccgagcggaaggagtacatcaacgctgtgaagtgtttg
gcttccaagccctccaagtcggatcccgcattcgctcctggtgcgcgcaaccgctacgat
gactttgtcgccgtccacattaatcagacctgggtcatccacgccactggaaacttcctg
acatggcatcgctacttcacctgggcctatgagcaagctctacgcaacgagtgcggctac
accggctaccaaccttactgggcctggaacaagtacgccgatgacccgctcaactcgccc
attttcgacggctccgagtacagcatgtccggcgacggagcctatatcccccacgaaggc
accgaggctgcgccgggtattgtcctcaagcccggaaacggtggtggctgcgtcaaggcg
ggcccattcaaggactggaaagtcaaccttggccccgtcttccccagcctcaaggtcccc
ggcgtcgtcgcccagaacggcagcggtctgggatataacccccgctgtctgcgccgcgac
atctccaaggatgccgcacggtggaccacaaccaactacgtggtggacttgatcaccaag
gagaataacatcctggacttccagaataccatgcagggtgacttccccaacggcttcctc
ggtgtgcacagcggcggccactacaccattggcggtgatccgggaggtgatttcttcgcc
tctcccggggaccctgctttcttcctgcaccattccgccatcgaccgtgcgttctggacc
tggcagaaccaggaccccgcgaagcgcacgtacgtcgtcgagggcccgaccgttctcccc
ggtctgactccggaccctcccaattccactctgaatgatatcgtggatatgagcagtgct
ctggcgccgcccaagaagatcaaggagcttctagacacgactggggggccgttctgctat
gtttatctgtga

DBGET integrated database retrieval system