KEGG   Aspergillus clavatus: ACLA_065720Help
Entry
ACLA_065720       CDS       T01148                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase Ugp1, putative
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
act  Aspergillus clavatus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ACLA_065720
   00052 Galactose metabolism
    ACLA_065720
   00500 Starch and sucrose metabolism
    ACLA_065720
   00520 Amino sugar and nucleotide sugar metabolism
    ACLA_065720
Enzymes [BR:act01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ACLA_065720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 521 aa AA seqDB search
MASKALPTHLRAPANDAGNNGGFGKHHGKSQSHMAFENASTSVAASQMRNALNALSETVT
DPNEKKRFEAEMDNFFALFRRFLNDKAKGNVVNWDRINPPQPSQVVDYNDLGTEASVEFL
NKLAVVKLNGGLGTSMGCVGPKSVIEVREGMSFLDLSVRQIEHLNRTYNVNVPFVLMNSF
NTDQDTQSIIKKYQGHNVDIITFNQSRYPRIIKDSLLPAPKSFDAPLQDWYPPGHGDVFE
SLYNSGTLDQLLERGVEYIFLSNADNLGAVVDLRILQHMVDTKAEYIMELTDKTKADVKG
GTIIDYEGKVRLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWMSLRAIKRVVEENELEMEI
IANEKSIPADKKGEADQAIYQLETAVGAAIRHFKNAHGVNVPRRRFLPVKTCSDLLLVKS
DLYRLEHGQLVMDPNRFGGVPVIKLGSDFKKVSDFQKRIPSIPRIVELDHLTITGAVNLG
RNVTLKGTVIIVATETSTIDIPPGSVLENCVVQGSLRILEH
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcctccaaagctttgcccacgcacctcagagcccctgccaacgatgccggcaacaat
ggcgggtttggcaagcaccacggaaagtctcagtctcacatggcctttgagaatgcctcg
accagcgttgcggcgtcgcagatgcgcaatgccctgaatgccctttccgagaccgtcacc
gaccccaacgagaagaagcgcttcgaggctgagatggacaacttcttcgctcttttccgc
agattcctcaacgataaggccaagggcaacgtcgtcaactgggaccgcatcaaccccccc
cagccctcccaggtcgtcgactacaatgacttgggcaccgaggcctcggtcgagttcctc
aacaagctggccgtcgttaagctgaacggtggtctgggtacctccatgggctgcgtcggc
cccaagtccgtcatcgaagtccgtgagggcatgtccttcctggatctttccgtccgccag
atcgagcacctgaaccgcacatacaacgttaacgtgcccttcgtgctgatgaactcgttc
aacaccgaccaggacacccagtccatcatcaagaagtaccagggccacaacgtcgacatc
atcacgttcaaccagtcccgctacccccgtatcatcaaggactcgcttctccccgccccc
aagagcttcgatgctcctctccaggactggtacccccccggccacggtgacgtctttgag
tcgctctacaactccggcacgcttgaccagctgctcgagcgtggtgtcgagtacatcttc
ctgtccaacgccgacaacctgggtgccgtggtggatctccgcatcctgcagcacatggtc
gacaccaaagccgagtacatcatggagttgaccgacaagaccaaggctgacgtcaagggt
ggtaccatcatcgactacgagggcaaggtccgcctgctggagatcgcccaggtgcccaag
gagcacgtcaacgagttcaagtccatcaagaagttcaagtacttcaacaccaacaacatc
tggatgagcctgcgcgccatcaagcgtgtggtcgaggagaacgagctggagatggagatc
atcgccaacgagaagtccatccccgccgacaagaagggtgaggccgaccaggccatctac
cagctggagaccgccgtcggtgcggccatccgccacttcaagaacgcccacggtgtcaac
gtcccccgtcgccgcttcctgcccgtcaagacttgctccgatctcttgctggtcaagtcg
gatctctaccgtctggagcacggtcagctggtcatggaccccaaccggttcggcggtgtg
cccgtcatcaagctgggttccgacttcaagaaggtctcggacttccagaagcgcatccct
agcatccctcgcattgtcgagctagaccacctgaccatcaccggtgccgtcaacctgggt
cgcaatgtcaccctgaagggaaccgtcatcatcgtggctaccgagaccagcacgatcgac
atcccccctggctcggtgctggagaactgcgtggtccagggtagcttgagaatcctggag
cactag

DBGET integrated database retrieval system