KEGG   Aspergillus clavatus: ACLA_066090Help
Entry
ACLA_066090       CDS       T01148                                 

Definition
cap binding protein
Orthology
K03259  
translation initiation factor 4E
Organism
act  Aspergillus clavatus
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:act00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ACLA_066090
Translation factors [BR:act03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    ACLA_066090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 246 aa AA seqDB search
MAAVAENGPVPVNDENTAPVAATEQNEKTEQTNGDTVTVFHDPENFNVKHPLMHEWTLWF
TKPPSGKGDNWNDLLKEVVTFNSVEEFWGIYNNISPTSELGLKADYHLFKKGIRPEWEDP
QNKHGGKWSYQFKDKRSVPIDDLWLHAQLAAIGETLENDGDSEVMGVVVNVRKGFYRVGL
WTRTVGKSIPGDKNGRTPAQGKEILENIGRRFKEVLRLKEADVVEFSGHTDSAHSGSTRA
KAKYTV
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagtcgctgagaacggacctgtaccggtaaacgacgagaacaccgctcccgtc
gccgccaccgagcagaatgagaagaccgagcagacaaatggcgacactgtcacagtgttc
cacgaccccgagaacttcaacgtgaagcatcctctcatgcacgaatggacactctggttc
actaagcctcccagtggcaagggagataactggaacgatctgctgaaggaagtcgtgaca
ttcaactcggtggaggagttctggggtatctataacaacatctcgcccacttctgagttg
ggcctcaaggcagactaccatcttttcaagaagggcatcagacccgaatgggaagacccc
cagaacaagcacggtggcaagtggtcataccagtttaaggacaagcgctcggtacctatt
gatgatctctggctgcacgcccaactggcagctatcggtgagactctcgagaacgatggc
gacagtgaggttatgggtgttgttgtgaacgtgcgtaagggcttctatcgtgtcggtcta
tggacacggacggttggcaagagcattcccggagacaagaacggccggacgcccgctcaa
ggcaaggaaattctcgaaaacattggtcggcgcttcaaggaggttctgcgcctcaaggaa
gcggatgttgtcgaattctcgggccacacggatagtgcacacagcggtagcaccagagcc
aaggcgaagtacactgtctaa

DBGET integrated database retrieval system