KEGG   Aspergillus clavatus: ACLA_066630Help
Entry
ACLA_066630       CDS       T01148                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
act  Aspergillus clavatus
Pathway
act00010  Glycolysis / Gluconeogenesis
act00071  Fatty acid degradation
act00350  Tyrosine metabolism
act01100  Metabolic pathways
act01110  Biosynthesis of secondary metabolites
act01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACLA_066630
  Lipid metabolism
   00071 Fatty acid degradation
    ACLA_066630
  Amino acid metabolism
   00350 Tyrosine metabolism
    ACLA_066630
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ACLA_066630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C adh_short AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 4704471
NCBI-ProteinID: XP_001272453
UniProt: A1CGE7
AA seq 350 aa AA seqDB search
MSVPEMQWAQVAEQVGGPLVYKQIPVAKPGPDEILVNIRYSGVCHTDLHAMHGHWPLPVK
MPLVGGHEGAGVVVAKGDLVTEFELGDHAGVKWLNGSCLACEFCKQAEDPLCPHALLSGY
TVDGTFQQYAIAKATHASKIPKHVPLDAVAPVLCAGITVYKGLKESGARPGQTVAIVGAG
GGLGSLAQQYARAMGLRVIAIDGGEEKRAMCESLGAEAYVDFTQSQDLVADVKAATPEGL
GAHAVILLAVSEKPFQQATEYVRSRGTVVAIGLPANAFLRAPVFNTVVRMINIKGSYVGN
RQDGVEAIDFFARGLIKAPFKVAPLKDLPQIFDLMEQGKIAGRYVLEMPQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtccccgagatgcaatgggcccaggtcgccgagcaggtcggtggccccctggtc
tacaagcagatccctgtcgctaagcccggtcccgatgaaatcctggtcaacatccgctat
tcgggtgtgtgccacaccgatctccacgccatgcatggccactggcccctccccgtcaag
atgcccctggtgggtggccacgagggtgccggtgtggtcgtcgccaagggtgatctggtc
actgagttcgaactcggcgaccacgcgggtgtcaagtggctgaacggctcctgccttgcc
tgcgagttctgcaagcaggctgaggaccctctgtgcccgcacgccctgctttcgggttac
actgtcgacggtaccttccagcagtacgccattgccaaggccacccatgcctccaagatc
cccaagcatgtgcccctcgatgcggtcgctcccgtgctctgcgctggtatcaccgtgtac
aagggtctgaaggagtccggcgcccggcccggccagacagtggcgattgtgggtgccggt
ggtggcctgggctccctggcgcagcagtatgcgcgcgccatgggcctgcgggtcatcgcc
attgacggtggcgaggagaagcgcgccatgtgcgagtcgcttggcgcagaggcctacgtc
gacttcacccagtcgcaggatctggttgccgacgtcaaggcggccacccctgagggtctg
ggtgcccacgcggtcattctgctggccgtctccgagaagcccttccagcaggcgaccgag
tatgttcgctcgcgcggtaccgtcgttgccatcggtctccccgccaatgcgttcctgcgc
gctcctgtcttcaacaccgtggtgcgcatgatcaacatcaagggcagctacgtcggtaac
cgccaggacggtgttgaggccatcgacttctttgcccgcggcctgatcaaggctcccttc
aaggttgcccctctgaaggatcttcctcagatcttcgatctcatggaacaaggcaagatt
gccggtcgctacgtcctcgagatgccccaataa

DBGET integrated database retrieval system