KEGG   Aspergillus clavatus: ACLA_066630Help
Entry
ACLA_066630       CDS       T01148                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
act  Aspergillus clavatus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ACLA_066630
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACLA_066630
  Lipid metabolism
   00071 Fatty acid degradation
    ACLA_066630
  Amino acid metabolism
   00350 Tyrosine metabolism
    ACLA_066630
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ACLA_066630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 350 aa AA seqDB search
MSVPEMQWAQVAEQVGGPLVYKQIPVAKPGPDEILVNIRYSGVCHTDLHAMHGHWPLPVK
MPLVGGHEGAGVVVAKGDLVTEFELGDHAGVKWLNGSCLACEFCKQAEDPLCPHALLSGY
TVDGTFQQYAIAKATHASKIPKHVPLDAVAPVLCAGITVYKGLKESGARPGQTVAIVGAG
GGLGSLAQQYARAMGLRVIAIDGGEEKRAMCESLGAEAYVDFTQSQDLVADVKAATPEGL
GAHAVILLAVSEKPFQQATEYVRSRGTVVAIGLPANAFLRAPVFNTVVRMINIKGSYVGN
RQDGVEAIDFFARGLIKAPFKVAPLKDLPQIFDLMEQGKIAGRYVLEMPQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtccccgagatgcaatgggcccaggtcgccgagcaggtcggtggccccctggtc
tacaagcagatccctgtcgctaagcccggtcccgatgaaatcctggtcaacatccgctat
tcgggtgtgtgccacaccgatctccacgccatgcatggccactggcccctccccgtcaag
atgcccctggtgggtggccacgagggtgccggtgtggtcgtcgccaagggtgatctggtc
actgagttcgaactcggcgaccacgcgggtgtcaagtggctgaacggctcctgccttgcc
tgcgagttctgcaagcaggctgaggaccctctgtgcccgcacgccctgctttcgggttac
actgtcgacggtaccttccagcagtacgccattgccaaggccacccatgcctccaagatc
cccaagcatgtgcccctcgatgcggtcgctcccgtgctctgcgctggtatcaccgtgtac
aagggtctgaaggagtccggcgcccggcccggccagacagtggcgattgtgggtgccggt
ggtggcctgggctccctggcgcagcagtatgcgcgcgccatgggcctgcgggtcatcgcc
attgacggtggcgaggagaagcgcgccatgtgcgagtcgcttggcgcagaggcctacgtc
gacttcacccagtcgcaggatctggttgccgacgtcaaggcggccacccctgagggtctg
ggtgcccacgcggtcattctgctggccgtctccgagaagcccttccagcaggcgaccgag
tatgttcgctcgcgcggtaccgtcgttgccatcggtctccccgccaatgcgttcctgcgc
gctcctgtcttcaacaccgtggtgcgcatgatcaacatcaagggcagctacgtcggtaac
cgccaggacggtgttgaggccatcgacttctttgcccgcggcctgatcaaggctcccttc
aaggttgcccctctgaaggatcttcctcagatcttcgatctcatggaacaaggcaagatt
gccggtcgctacgtcctcgagatgccccaataa

DBGET integrated database retrieval system