KEGG   Aspergillus clavatus: ACLA_067520Help
Entry
ACLA_067520       CDS       T01148                                 

Definition
cytochrome b5-like heme/steroid binding domain protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
act  Aspergillus clavatus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ACLA_067520
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ACLA_067520
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     ACLA_067520
Lipid biosynthesis proteins [BR:act01004]
 Desaturase
  First
   ACLA_067520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 372 aa AA seqDB search
MHDLRLSGEPTYFFFSVVTMINSQTPGVAPLNDGTTDYVPLRKHSIGTSHISDQPMAWTN
WPKAYWTPLHPLTALLAVVYHFNAGLGITAGHSSITDLPCCGWGCSGTGFDSLVGSRSLS
PPPLYRHGERPNFSAQRVLIFTYWPASYQAELQKVEMTDVADPDANPVVVWQHKNFIKSA
LFMTLIFPTLACGLGWGDLRGGLIYSGILRVFFIQQATFYWGQYDPTKWAIWIWKKLGVA
YDLKQFRKNEISKGRLQQLQKKIGGSRWSSPVLDWDGFVTESASRALVAIGGVIPDVFNF
IQEDPGGKAFISSVIGKDGTGMFNGAIYQHSNAAHNLLLMRRVGVLRGGCEVEIWKYAMA
EAKHRQVMPETR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcatgatctgcgactttctggggaaccaacttatttttttttttctgtcgtcaccatg
ataaatagccagactcctggtgttgcgcccctcaatgatggcactacagattatgttcct
ctgcgaaagcactccatcggaacatcgcatatttctgaccaacctatggcatggacaaac
tggcccaaggcctattggacacccttacatcctctcacggctctacttgcagttgtctat
cacttcaatgccggccttggcataacagctggccactcttccattacagatctaccttgc
tgcggttggggctgcagcgggacagggtttgattcgctggtgggctcgcggtcactgagc
ccaccaccactatacagacatggagaaagacccaatttcagtgcgcaaagggttctgata
ttcacatattggccagctagttatcaagcagaactacaaaaggttgaaatgacagatgtc
gctgatcctgatgctaatcctgtggtggtttggcagcacaagaatttcatcaaatctgcc
ctcttcatgacgttgattttccctaccttggcttgcggcctgggatggggcgatttgcgt
gggggtcttatatacagtggtattctgcgcgttttcttcattcaacaggccaccttctac
tgggggcaatatgatccgaccaagtgggcaatttggatctggaagaagctcggagttgct
tatgatttgaagcagttccgcaaaaatgagatttcaaagggccgtctgcagcagttgcag
aagaagattgggggatcccgctggagcagccctgtcctggactgggacgggtttgtcacc
gagtctgctagcagggccctagtcgccattggaggcgtcatccctgatgttttcaacttc
atccaggaggacccgggtggtaaggcattcatttcatcggtaattggcaaagatggcacc
ggcatgtttaatggggccatctatcagcattctaacgctgcccataatcttctgttgatg
aggcgtgtaggtgttctccgaggtggctgcgaagtagagatttggaagtacgctatggcg
gaggctaagcaccgacaagtcatgccagagactcgataa

DBGET integrated database retrieval system