KEGG   Aspergillus clavatus: ACLA_067990Help
Entry
ACLA_067990       CDS       T01148                                 

Definition
ubiquitin C-terminal hydrolase, putative
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     ACLA_067990
Peptidases [BR:act01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   ACLA_067990
Exosome [BR:act04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ACLA_067990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 772 aa AA seqDB search
MLIYKLFIHPRNPKLSIVKIDDDAGLNVCLSCFNGGCAGDRNHAELHYKRFGHPLALNMK
RSRKKVQRDEPPPKISKLAIAAETDEDRYDTATYVVCYQCHSDRIDPSSGNLPDVIGGVM
KALTFSKREEIKAWEQEFVPCEHTLCLVQQDSKRIESQELSQCSMCPLKENLWLCLECGN
LGCGRSQFGGMGGNSHALAHADSTSHAVAVKLGSITADGNADIYCYKCTEERTDPALATH
LAHWGVNLSGREKTEKSLMEMQVEHNLRWEFSMTTEDGHELTPIFGPGFTGLANLGNSCY
LSSVIQCLFSLPEFQQRYYRGGDEPPLTAKPAEDLETQMEKLADGILSGRYSKPNVDVFA
SPDSAEVPPQKGLLPSMFKFLVGSGHEEFSTMRQQDAFEFLLHLFKLLQRMQCPEEGKNP
IECFQFALEQRLQCQSCRKVRYRLDEQDNVSIPVPVRRLPVSGDTTSVAQFGTVTLFECL
AAFTASETVELSCPACGSKDGFSKRSSFKTFPQELVINARRFEVVNWVPTKLDIPVDVSD
APLDFTPYLSSDREHGEESLPDEDISNSVFLPDHDALDQLLAMGFPRIRCERALYSTGNS
NAEDAMNWLFAHVDDPDIDEPVVRDQVSAGAHMDQQDPQAVAQLSEMGIDEKRARKALAA
SDGDVNRAIDWVFSHPDDASDSHTSESQSGSRLGSHGRTPGSFDTPAMYQLRAIVCHKGS
SVHAGHYVAFVRKVLPGEDASSWVMFNDEKVVKVDDIQEMKKYAYLYFFSRV
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atgttaatctacaagctcttcatccaccctcggaatcccaagctgtctatcgtgaagatt
gatgacgacgctgggttgaatgtttgtctctcttgcttcaatggaggctgtgcgggcgat
cgcaatcatgctgagctacactacaagcgcttcggtcaccctttggctctcaacatgaaa
agatcgcgaaagaaggtacagcgcgacgaacctccacccaagatctcaaaactcgcaatc
gcagcagaaacagatgaagatcgttacgacacagcaacttacgtcgtttgctatcaatgt
cactccgatcggattgatccatcaagtggcaaccttccagatgtgatcgggggtgtcatg
aaggccttgacgttctcgaagagagaagagatcaaagcctgggagcaagagtttgttccc
tgtgagcatacactctgtttggtccagcaagactccaaacggattgaatcccaagaactc
agtcagtgctcaatgtgccctctcaaggaaaatctgtggctttgcttggaatgtggcaat
ctcgggtgcggacgcagccaatttggtgggatgggaggcaattcacatgcacttgcacat
gcggactcgacatcccatgccgtagccgtcaagcttggctcgataactgcagatgggaat
gctgacatttactgttacaaatgtactgaagaaaggacagatccagctcttgcgactcat
ctcgctcactggggggtcaacctgagcggtcgtgaaaaaaccgagaaaagtctaatggaa
atgcaggtcgagcacaatttgcgatgggagttctcgatgacaactgaggatggccacgag
ctcacgccaattttcggccctggtttcacagggttggccaatcttggaaatagttgctat
ctctcaagcgtcattcagtgcttattttctctcccggaatttcagcaaagatactatcgt
ggtggcgacgagccaccattgaccgctaaaccggccgaggatctagagactcagatggag
aaacttgctgatggcattctttccggtcgttattcaaaacccaacgtggatgtgtttgcc
tcgcccgattcagcggaagttcctccccagaaagggctgttgccatcaatgttcaaattt
cttgtggggagtggtcatgaggagttctcgacgatgaggcagcaggatgcgtttgaattt
ctcctccacctattcaaactgcttcaaaggatgcaatgtcccgaggagggaaagaatcct
atcgaatgttttcagttcgctcttgagcaacgtcttcagtgccagtcctgtaggaaagtc
cgctaccgattggatgagcaagacaacgtctccattcccgtccctgtccgtcgactccct
gttagtggtgatacgacctctgtggctcaattcgggacggtgacgctattcgagtgcctg
gctgctttcactgcgagcgaaaccgttgagctcagttgccctgcctgcggaagcaaggat
ggattctcgaaacgatcttcattcaagactttcccacaggaattggtaatcaacgcccga
cgatttgaggttgttaattgggttcccaccaaattagatattccggtagacgtcagcgat
gcgccattggatttcaccccgtatctaagcagcgatcgggaacatggcgaggaatctctc
ccagacgaggacatctcgaacagtgtgttcttgcctgatcatgatgctcttgaccagctt
cttgccatgggctttcctcggatcaggtgtgaaagggcactttattcgacaggcaactcc
aatgctgaggatgcaatgaactggctttttgcccatgtggacgatcctgatattgatgaa
cccgttgtacgggaccaggtctctgcgggagcccacatggaccagcaagatccacaggcg
gtggctcaattgagcgagatgggcatcgatgaaaagcgcgccaggaaggccttggctgct
tcggatggtgatgtgaatagggccattgactgggttttcagtcatccggatgatgcttct
gacagtcatacttccgagtctcagtcaggatctcggcttggtagccatggccgaacacct
gggtcttttgataccccagctatgtatcaacttcgtgccattgtttgccataaaggatct
tcagttcatgcaggtcactatgtcgcatttgttcggaaagttctgccaggcgaagatgct
tcatcatgggtcatgttcaatgatgagaaggttgtgaaggttgatgatattcaagagatg
aagaaatatgcatatctctatttcttctctcgggtctaa

DBGET integrated database retrieval system