KEGG   Aspergillus clavatus: ACLA_068160Help
Entry
ACLA_068160       CDS       T01148                                 

Definition
protein disulfide isomerase Pdi1, putative
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
act  Aspergillus clavatus
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:act00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    ACLA_068160
Enzymes [BR:act01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ACLA_068160
Exosome [BR:act04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ACLA_068160
  Exosomal proteins of colorectal cancer cells
   ACLA_068160
  Exosomal proteins of bladder cancer cells
   ACLA_068160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 518 aa AA seqDB search
MRSFAPWIVSLLGASVVVSATDTSADAPSDVVTLTKDSFDDFMKAHDLVLAEFYAPWCGH
CKALAPKYEEAATELKGKNIPLVKVDCTAEEELCRDNGVEGYPTLKIFRGPESSKPYQGA
RQADSIVSYMVKQSLPAVSPVTEDNLEDVKTMDKIVVIGYLPSDDKAANDAFTSFAESQR
DNYLFAATSDSAIAKAEGVKQPSIVLYKDFDEKKAVYDGKLDQEAILSWVKTASTPLVGE
IGPETYSGYMAAGIPLAYIFAETQEEREKFTEDFKPIAEKHKGAINIATIDAKMFGAHAG
NLNLDPQQFPAFAIQDPEKNTKYPYDQTKEINAKDIAKFIQDVLDGKVEPSIKSEPIPET
QEGPVTVVVAHSYQDLVIDNDKDVLLEFYAPWCGHCKALAPKYDELAALYSGDLASKVTI
AKIDATANDVPDSITGFPTIKLYPAGAKDSPVEYSGSRTVEDLADFVKENGKHKVDGLEA
SSQETEEGADVTASASASSTETEAPAATEDEKADHDEL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccttcgctccctggatcgtgagccttctaggcgctagcgtagtggtctctgcc
accgacacctcggcagatgctccctctgatgttgttaccctgaccaaggactcatttgat
gatttcatgaaggcgcatgacctggtgttggctgagttctatgccccttggtgtggtcac
tgcaaggctctggctcctaagtatgaggaggctgccactgagctcaaggggaagaacatt
cccttggtcaaggtcgattgtactgcggaagaagaactatgcagagacaatggtgttgaa
ggctatcccaccttgaagattttccgcggtcctgagtccagcaagccgtaccagggagct
cgacaggctgattcgatcgtctcttatatggtcaagcaatcacttcctgccgtgtcccca
gtcaccgaggataacctggaggacgtgaagactatggacaagattgtcgtcattggctac
cttccctctgacgacaaggctgccaacgatgcattcacatccttcgccgagtcgcagcgc
gataactatctatttgccgccacaagtgactccgctatcgccaaggcagagggtgtcaag
cagccctcgattgtcctgtacaaggatttcgacgagaagaaggctgtttatgatggaaaa
cttgaccaagaggccattctcagctgggtgaagactgccagcaccccacttgtcggcgag
atcggacccgagacctactctgggtatatggcagccggtattcccctggcatatatcttc
gccgaaacccaggaagaacgcgaaaaattcaccgaggacttcaagcccattgctgagaag
cacaagggagccatcaacatcgccactattgacgcgaagatgttcggagcccacgctgga
aacctcaaccttgacccccagcagttcccggcattcgctattcaggatcctgagaagaat
accaagtatccttatgaccaaaccaaggagatcaatgccaaggacatcgccaagttcatc
caagatgtccttgatggcaaggttgagcccagcatcaagtccgagccaattcccgaaacc
caagaaggccccgtcacggtcgtggtcgcccattcctaccaggatctcgtcattgacaac
gacaaggatgttcttctcgaattttatgcaccttggtgcggccactgcaaagctcttgct
cccaagtatgacgagctcgcagctctctattcgggcgaccttgcctctaaggtcactatt
gctaagattgatgccacggccaatgatgtgcccgattccattactggcttccccaccatc
aagctctatcccgctggtgccaaggactccccagtcgaatattctggctctcgcaccgtt
gaggatctcgccgacttcgtcaaagagaatggcaagcacaaggtcgatggccttgaagct
agctcccaggaaacagaagagggcgccgatgttaccgcctctgcctcggcttcgtccact
gagaccgaagctcctgctgccacggaggacgaaaaggccgatcatgatgagctgtag

DBGET integrated database retrieval system