KEGG   Aspergillus clavatus: ACLA_068590Help
Entry
ACLA_068590       CDS       T01148                                 

Definition
agmatinase, putative
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
act  Aspergillus clavatus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ACLA_068590
Enzymes [BR:act01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     ACLA_068590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 420 aa AA seqDB search
MKTTCWAGFLALAGTALAHAHHDDAEVVPQSLREELLKKWDQEFTFSGIASFAHLKPVKC
LVEPDERYDIAVIGAPFDTAVSYRPGARFGPRAIRAASARQMAGTSYNTRAGINPYSSWA
TVKDCGDIPITPFDNGLAERQMYEAFLELGVRPAATPADSRYGTKGISAGRAKLVTLGGD
HSVALPALRALYQIYQKPITVLHFDAHLDTWNPVRYSAYWMSEQSHFNHGSFFHKASREG
LICNATSAHAGLRTRLTGIDDSDYTSSNTPEQGFMRIHADDIDELGPVGIIDKLIDRIGL
DRDQPVYLSVDIDVLDPATAPGTGTPEPGGWTTREFIRILRGIEKLNVVGADIVEVSPSY
DNMGETTALAAAQVAFEIITSLVKAGAGEDLGGWYGRKVDGEVSVEEEIVREEAQAKDEL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaagactacttgttgggcgggattcttagcattggctgggacggcgctggcccacgcc
caccacgatgatgcggaggtcgtcccccagagtctgcgcgaggaattgctgaagaagtgg
gatcaggagtttacgttctccggcatcgccagcttcgcccacttgaagcccgtcaagtgc
ctggtcgagcccgatgagcgatacgatatcgcggtcattggcgctccctttgacacagcc
gtcagctacagacccggcgctcgtttcggcccccgtgccatccgcgccgccagcgcccgc
cagatggccggcaccagctacaacacccgcgcaggaatcaacccgtacagctcctgggca
acggtgaaggactgcggcgatatccccatcacgccgttcgacaacgggctcgccgagcgc
cagatgtacgaggccttcctggagctcggggtccgccccgccgcgacccccgccgactcc
cggtacggcacgaagggcatttccgccgggcgcgcgaagctggtgacgctgggcggcgac
cacagcgtggcgctgccggcgctgcgcgcgctgtaccagatctaccagaagccgatcacg
gtgctgcatttcgacgcgcacctggacacgtggaacccggtgcggtactcggcctactgg
atgtcggagcagtcgcacttcaaccacggcagtttcttccacaaggccagccgcgagggg
ctgatctgcaacgcgacgtccgcgcacgccggcctgcgcacccggctcaccggcatcgat
gacagcgactacacaagctccaacacccccgagcaagggttcatgcgcatccacgccgac
gacatcgacgagctgggccccgtcggcatcatcgacaagctcatcgaccgcatcggcctc
gacagggaccaacccgtctacctctccgtggacattgacgtgctggacccggccaccgcc
ccaggcacgggcaccccggagcccggaggctggaccacccgcgagttcatccgcatcctg
cgcggtatcgagaagctcaatgtcgtcggcgcggatatcgtcgaagtctcgccgagctac
gacaacatgggtgagacgaccgcgctggccgcggcgcaggttgcctttgagatcatcacg
agtctcgtcaaggccggtgccggcgaggatctaggcggctggtacggacgtaaggttgat
ggcgaggtttctgtggaagaagagattgttcgtgaggaagcgcaggcgaaagatgaattg
taa

DBGET integrated database retrieval system