KEGG   Aspergillus clavatus: ACLA_068920Help
Entry
ACLA_068920       CDS       T01148                                 

Definition
folic acid synthesis protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
act  Aspergillus clavatus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ACLA_068920
Enzymes [BR:act01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ACLA_068920
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ACLA_068920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 457 aa AA seqDB search
MHRAYIALGSNVGARVEMIEKACQEMERAHIRVKRTSSLFETAPMYVLDQDPFMNGVCEV
ETRLGPLELLDTLQSIELALGRKKLIDKGPRSIDLDILLYDQEIFSHERLNIPHKLMLER
DFVLRPLCQLIPLELPPLPGQHGSYLSYLQSLPPPAPVPVATTYISPNFPPLRSTDPTRP
THLMAILNVTPDSFSDGGKHWSQDPAALTATIRGFIDAGATIIDIGGESTRPGAHPVGEA
EELARVIPVIRHIRTAMPEARRIALSIDTYRAKVAEAACAAGADIINDVSAGTLDRDMLP
TMARTGKAVILMHMRGDPATMTSLATYPNGVIADVGAELRERVAAAEAAGVRRWRMILDP
GLGFAKNQTQDLAILRDLQRFRDGVAGLEYFPWLMGPSRKRFIGRLTGVEKASERTWGTA
ATVTASIAGGADIVRVHDVKEMWQVAKVADAIYRVDS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgggcctacattgcccttgggagcaatgtgggcgcccgcgtcgagatgattgaa
aaagcttgccaggagatggaaagggcccacatcagagtcaagaggacgagttctcttttc
gagaccgcgccgatgtatgttctcgaccaggaccctttcatgaatggcgtctgcgaggtg
gaaacccgcttagggccgcttgagttgctggataccttgcaatccattgagctggctctg
gggcgaaagaagctcatcgataaaggccccaggtccattgacttggatatcctgctctat
gaccaggagatcttctcgcatgagcgcttgaacatcccccacaagctgatgctcgagagg
gactttgtattacggcctctctgccaactcatcccgctggagctgccccctcttccaggg
cagcacgggagctatctctcctacctccagtcactcccgcccccggcgccagtccccgta
gccacgacgtacatctcccccaatttcccacccctgcgctccaccgacccgacccgccca
acacacctcatggccatcctcaacgtcacgcccgactccttctccgacggcggcaagcac
tggtcgcaagaccccgccgcgctcaccgccaccatccgcggcttcatcgacgccggcgcc
accatcatcgacatcggcggcgaaagcacccgcccgggcgcccaccccgtcggcgaagcc
gaggagctcgcccgcgtgattcccgtcatccgacacatccgcaccgccatgcccgaagcc
cgccgcatcgccctcagcatcgacacctaccgcgccaaagtcgccgaggccgcctgcgcc
gccggcgccgacatcatcaacgacgtctccgccggcacgctcgaccgggacatgctcccc
accatggcccgcaccggcaaagccgtcatcctgatgcacatgcgcggcgaccccgccacc
atgacctcgctcgcaacgtatccgaacggggtcatcgcggacgtgggcgcggagctgcgc
gagcgcgtcgcggccgccgaggctgcgggcgtgcgccgctggcgcatgatcctggacccg
ggcctcggcttcgccaagaaccagacgcaggacctggccatcttgcgggacctgcagcgg
ttccgggacggggtcgccgggctggagtatttcccgtggctgatggggccgagccggaag
cggttcattggccggcttaccggcgtggagaaggcgagtgagcggacctggggcactgcc
gcgacggtgacggcgagcattgcggggggagcggatattgtgcgtgttcatgatgtgaag
gagatgtggcaggtggcgaaggtggcggatgccatataccgtgtggattcgtga

DBGET integrated database retrieval system