KEGG   Aspergillus clavatus: ACLA_069300Help
Entry
ACLA_069300       CDS       T01148                                 

Definition
TOR pathway phosphatidylinositol 3-kinase TorA, putative
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
act  Aspergillus clavatus
Brite
Protein kinases [BR:act01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   ACLA_069300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2369 aa AA seqDB search
MAQAGPITDVTQRLFVELKSRNEETRANWPPEKFLEFYNAVSQRIAQLVVTGSDAHERIG
GLLALDRLIDFDGVDAAQKTTRFASYLRSALRSNDNAVLVYAARSLGRLAKPGGALTAEL
VESEIQSALEWLQSERQESRRFAAVLVIRELAKGSPTLLYGFVPQVFELIWVALRDPKVL
IRETAAEAVSECFEIIAARDAQVRQLWFARIYEEALLGLKSSNVDWVHGSLLVLKELLLK
GAMFMNEHYRNACEIVLRLKDHRDHKIRAQVVQTIPILASYAPVDFTEIYLHRFMIYLQA
QLKRDKERDAAFIAIGKIANAVGPAIAQYLDGIIIYIREGLAMKARNRAAINEAPMFECI
SMLSLAVGQTLSKYMESLLDPIFACGLSESLTQALVDMAHYIPPIKPTIQEKLLDMLSLI
LHGTPFRPLGCPESRLPPMPSFAKDFAPQELHSDAEIALALHTLGSFDFSGHILNEFVRD
VAINYVEKDNPEIRKAAALTCCQLFVHDPIINQTSSHSIQVVSEVIDKLLTVGVGDPDPE
IRRTVLWSLDRKFDRHLARPENIRCLFLAVNDEVFAVREAAICIIGRLSSVNPAYVFPPL
RKLLVNLLTGLGFASTARQKEESAQLISLFVSNATKLIRSYVDPMVTTLLPKATDANPGV
ASTTLKAVGELANVGGAEMRNYLPQLMPIILDSLQDLSSHAKRESALRTLGQLASNSGYV
IDPFLEYPHLLAVLINIIKTEQTGSLRKETIKLLGILGALDPYKYQQISEIEPDVHHINE
IQTVSDVALIMQGLTPSNEEYYPTVVIHTLMQNILRENSLAQYHSAVIDAIVTIFKTLGL
KCVPFLGQIIPGFISVIRGAPPSRLESYFNQMAILVNIVRQHVRAFLPEIIDVIREFWDA
SYQVQATILSLMEAIAKSLEGEFKKYLAALIPSMLDTLEKDTTPRRQPSEKILHAFLVFG
TSGEEYMHLIIPSVVRLFERTQNPQSVRKSAIESLTKLSRQVNVSDFSSLMIHSLARVVA
GNDRALRQSAMDCICALIFQLGQDFCHYINLLNKVLKNNQINHVNYQILVSKLQKGDPLP
QDLNPDENQATMADESSYSDVGQKKMVVNQQHLKNAWDASQKSTREDWQEWIRRFSVELL
KESPSPALRACASLAGIYQPLSRDLFNAAFVSCWTELYDQYQEELVRSIEKALTSPNIPP
EILQILLNLAEFMEHDDKALPIDIRTLGKYAAKCHAFAKALHYKELEFEQDQNSGAVEAL
ITINNQLQQSDAAIGILRKAQAYRDVELKETWFEKLQRWEEALAAYKRREKIDPDSFGVT
MGKMRCLHALGEWKVLSDLAQEKWNQASLEHRRAIAPLAAAAAWGRGQWELMDSYLGVMK
EQSPDRSFFGAILAIHRNQFDEATMYIEKARNGLDTELSALLGESYNRAYNVVVRVQMLA
ELEEIITYKQNVGDPEKQESMRQTWNKRLLGCQQNVEVWQRMLKVRALVTSPRENLDMWI
KFANLCRKSNRMGLAERSLASLETVINDSNGPRTIAPPEVTYARLKFNWATGRQRDALQM
LKEFTSNLTDDLNRFNALMVSQSEHSGMNGVNGITESNHADIMGLRERIGDVAKFRRLLS
KSYLRQGEWQTSLQRGDWKPEHVREVLGAYSAATKYNRDSYKAWHSWALANFEVVTTIAS
QASRDGTVKPVVPGHIVAEHVIPAIGGFLRSIALSSTSSLQDTLRLLTLWFTYGGDQEVN
NVVTEGFTAINIDTWLAVTPQLIARINQPNLKVRTAVHRLLAEVGKTHPQALVYPLTVAM
KSHITRRSQSASTIMDSMRQHSATLVEQADLVSHELIRVAVLWHELWHEGLEEASRLYFG
DHDVEGMFSTLAPLHEMLDKGAETLREVSFAQAFGRDLAEAKHYCMLYRETEEIGDLNQA
WDLYYTVFRKISRQLPQLSTLDLKYVSPRLKDCHDLALAVPGTYQSGRPIIRIISFDPIL
HVLQTKKRPRRMTLKGSNGSSYMYALKGHEDIRQDERVMQLFGLVNTLLDNDGETFKRHL
SVQRFPAIPLSQSSGILGWVCNSDTLHALIKEYRESRRILLNIEHRIMLQMAPDYDNLTL
MQKVEVFGYAMDNTTGKDLYRVLWLKSKSSEAWLERRTNYTRSLGVMSMVGYILGLGDRH
PSNLLLERATGRVVHIDFGDCFEVAMHREKYPERVPFRLTRMLTFAMEVSNIEGSYRITC
EAVMRVIRDNKDSLMAVLEAFIHDPLINWRLNIRESPERPPFSTERRQSVTSVINLEHGV
QPSNFSRHRRPSILDGGILDVQEGIPPEAREAQNARAVQVLARVKEKLTGRDFKPSEELN
VSDQVDKLLAQATSVENICQHWIGWCSFW
NT seq 7110 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagcaggtcctatcacggacgtcacccagcgactctttgtcgagttgaagtct
agaaatgaggagacacgggcaaattggcctccggagaagttcctcgaattttacaatgct
gtcagtcaacgcatcgcgcagctcgtggttacgggaagtgacgcacatgaacgaatcggt
ggcttgttggcgctcgatcggttaatcgattttgatggtgtcgatgccgctcagaagact
actcggttcgcaagctatctgcgcagcgctcttcgcagcaacgataacgcggtattagtc
tacgcagccagatccctcggacgtctggcaaagccgggcggagctcttactgcggaattg
gtcgaaagtgagatacaatcggcgttagaatggcttcaatccgaacggcaagaaagcaga
cgcttcgctgctgtgttagttatccgagagcttgccaagggctcgccaactctactttat
ggctttgtcccccaggtctttgagctcatctgggttgccctgcgggaccccaaagtcctt
atccgagaaacagccgctgaagcagtatccgagtgttttgaaattatagctgcgagagac
gcccaagttcggcaactgtggttcgcaaggatatacgaggaggcgctgctcggccttaaa
tccagcaatgtggattgggtacacggctcgctcttggttctaaaagagcttctccttaaa
ggtgctatgttcatgaacgagcattatcggaatgcctgtgagattgtcctccgcctcaag
gatcaccgcgatcacaagatccgtgcccaagttgtccagaccatccctattctcgcctcc
tacgcccctgtcgatttcacagagatctacctccatcgatttatgatatatttgcaggcg
cagctaaagagagataaagagcgtgatgcagcattcatcgccattggaaaaatcgccaat
gcggttggtcccgccatcgcacaatatctcgatgggatcatcatctacatacgcgaagga
ttagccatgaaagctcgcaatcgagccgccatcaacgaagcaccaatgtttgagtgcatc
agtatgttatccttggccgttggacagacgctcagcaaatatatggaatcgctgctcgac
cccatattcgcatgtgggctgagcgaatcactcacgcaagcgctcgtggatatggctcat
tatatccctcccataaagcctacgatacaggagaagctcttggatatgctcagtcttatc
cttcatgggacgccatttcgcccactcggatgcccagagagcaggttaccgcccatgccg
tcatttgcgaaagattttgcaccgcaagagttgcactccgatgccgagatcgcgttggca
cttcacactcttggtagtttcgacttctctggccatattctcaacgaatttgtgcgtgat
gtcgctattaactacgtcgagaaggacaaccccgaaataagaaaagccgcggcactcact
tgctgccagcttttcgtccatgatccgatcattaaccagacaagcagccattccatccaa
gtcgtgagtgaagtgattgacaagttgttgaccgtcggtgttggcgacccagatccggaa
attcgtcgcactgttctctggtcattggatcgcaagtttgatcgtcatcttgcgaggcct
gaaaacattcgctgtttattcttggccgtcaatgatgaagtttttgcagtccgagaagct
gcaatttgcatcattggccgtctgtccagtgtcaatccggcctacgtattccctcctcta
cggaaactccttgtcaatcttcttactggcctcggatttgcaagcacagcgcggcaaaag
gaggagagtgctcagctcatcagcctgttcgtctcgaatgcgacaaagctaatcaggtct
tatgtcgaccccatggtgacaaccttgcttccgaaggccacggatgctaaccctggcgtc
gcctcaactacattgaaggctgtcggagagcttgcgaatgttggaggcgcggagatgagg
aactatctccctcagctcatgcctattatcttggactcgctccaggatctttcctctcat
gctaagcgagagtcagctttgcggacgctgggccagttggccagcaactctggctatgtt
attgacccctttcttgaatacccccatttacttgccgttctcatcaacatcatcaagacc
gaacaaaccggttcccttcgtaaggaaaccatcaagctactgggaatactgggtgctctt
gatccgtacaaatatcaacagatcagcgagattgaacctgatgtccaccacatcaacgag
attcaaacggtctccgatgttgctctcatcatgcagggacttactccctctaatgaggag
tactaccctactgtggtgattcacaccctgatgcagaatattttgcgcgaaaactccctt
gctcaatatcactccgcagttatcgacgcgatcgtcaccatcttcaagactttgggtttg
aagtgtgtgccgttcctcggccagatcatccctggcttcatttcggtcatcagaggagcg
ccaccgagtcgccttgaatcctactttaaccagatggccattctggtaaacattgtccgc
cagcatgttcgcgcttttcttccggagattatcgatgtcatacgggaattctgggatgca
tcctatcaagttcaagcgacgatactttccctcatggaagccatcgccaagtccttggaa
ggcgaattcaagaaatacctggctgctcttattccttctatgctggacaccctcgaaaag
gataccacgccgcgccgccagccttcagagaaaattctccatgcctttcttgtttttggc
acaagtggggaggaatacatgcatttgattattccatcggtggtacgcctgtttgaaagg
actcaaaacccgcagagtgttagaaaatctgccattgagagtctgacgaagctttcccga
caagtaaatgtttccgacttctcttcattgatgatccactctttggctcgagttgttgcg
ggcaacgaccgggccttgagacaatcagctatggactgtatttgtgccctaatctttcaa
ctcggtcaagacttttgccactacataaatctgttgaacaaggtcttgaagaacaaccaa
atcaatcacgtcaattatcagattctggtttcgaaacttcaaaaaggcgatcctcttccg
caggatttgaaccccgatgagaatcaagccaccatggcggatgagtcaagctattctgat
gttggccagaaaaagatggttgtgaaccagcagcacttgaagaatgcctgggatgcttct
cagaaatcaacacgggaggattggcaggaatggatacgccgtttcagtgttgagctactt
aaagagtcaccctcaccagctctacgtgcttgcgcaagtttggccggcatctaccagccg
ctctcaagagatcttttcaacgctgctttcgtgtcctgctggaccgaactgtacgatcag
tatcaagaagagcttgtacggtcgatcgagaaggcgctcacctcacccaacatccctcct
gagatacttcagattttgctcaatcttgccgagtttatggagcatgatgacaaggctctt
cccattgacattcgtacactaggcaaatacgccgcaaaatgccatgcttttgcgaaggcg
ctccattacaaagagctggaattcgagcaagatcagaattccggggctgttgaagccttg
atcaccattaataaccaactgcaacaatccgacgctgccattggtatcctccgcaaagcc
caagcctatcgagatgtggagttgaaggagacctggttcgagaaactccagcgatgggaa
gaggcgcttgctgcctacaaacgccgggaaaagatcgatccagattcttttggtgtcacc
atgggcaagatgcggtgtctgcatgcacttggcgagtggaaggtattgtctgaccttgcc
caggagaagtggaaccaggcttcgctagaacatcgcagagccattgctcccctagcagca
gctgctgcctggggacgaggccagtgggagttgatggactcttacctgggtgtaatgaag
gagcagtcaccggatcggtcattctttggtgcgatcctcgcaattcatcggaaccaattt
gatgaagcgaccatgtatattgagaaagcacggaatggcctcgatacggagctgtcggca
ttgcttggagaatcgtacaaccgtgcatacaacgtcgtcgtccgtgttcaaatgcttgcg
gaactggaggagatcattacatacaagcagaacgtcggcgatcctgagaagcaggagtcc
atgcgccagacgtggaacaagagattacttggttgccaacagaatgttgaggtctggcaa
cgcatgctcaaggttagggcgcttgtcacttcgccacgtgagaacctcgatatgtggatc
aagtttgccaacctatgccgtaaatctaaccgcatgggacttgctgaacggtctcttgca
tccttggagaccgtcatcaatgacagcaatggtccacggaccattgctcctccagaggtg
acttacgctcggctaaagttcaactgggctacaggccgtcagcgtgacgcccttcagatg
ctgaaagaattcacctcaaatttgacagatgacctcaaccgcttcaatgcgctcatggta
tcacagtctgagcatagtggtatgaacggtgtcaacggtatcaccgagtcaaaccacgcc
gacattatgggtctacgcgaacggattggcgacgtagccaaattccgtaggctcctttcc
aaaagctatcttaggcaaggagaatggcaaacgtctctacaacgaggcgattggaagccc
gaacatgtccgtgaggtactcggtgcttactcagctgccaccaaatacaaccgtgactcg
tacaaagcctggcactcttgggcattggcgaactttgaagtcgtgacaacaattgccagt
caggccagtagggatgggactgttaagcccgtagtacctgggcatatcgtggcggagcat
gtcatccctgctattggagggtttctcaggtcgatcgctttgtcgtcaacttcgtctctt
caagatacattgaggttactcaccttgtggttcacttatggtggcgaccaggaagtaaac
aacgttgtcacagaagggtttacggcgataaatattgatacatggctcgcggtcacccct
caactcatcgcacgtatcaaccagccaaacctcaaggttcggacggctgtacatcgactt
ctggccgaagttggcaagactcatccgcaggcactggtatacccattgactgttgcgatg
aaatcacatattacccgccgttcacagtccgccagcactatcatggacagtatgcggcag
cacagtgctactttggttgagcaagctgatcttgtgagtcatgagctgattcgggttgca
gtcttatggcacgaactctggcatgaaggtctggaagaagcttctcggctttactttggt
gaccatgatgtggagggcatgttctccactctcgcacccctccatgaaatgctggacaag
ggtgcggaaaccctacgtgaggtttctttcgctcaggcgtttgggcgcgatcttgccgag
gcaaagcactattgtatgctgtatcgcgaaacggaagagattggtgatctgaatcaggct
tgggacctctattacactgtgttccggaagatcagccggcagcttccacagttatcgact
ctcgatcttaaatatgtgtcgcccaggctgaaagactgccacgatcttgcccttgctgtt
cccggaacctaccagagtggtcgtcctatcattcgtatcatcagctttgaccctatactg
cacgtgctacaaaccaagaagcggcctcgaagaatgactctgaagggaagcaatggaagc
tcgtacatgtatgctctcaagggacatgaggacatccggcaagatgagcgagtcatgcaa
ctgtttggtcttgtcaatactctgctcgataacgatggtgagacattcaaacgccatttg
tcggtacagcggttccccgctattccgctgtctcagagctctggtatactgggatgggtc
tgcaatagtgatacattgcacgcacttatcaaggagtaccgtgagagtcgccgcattcta
ctcaatatcgaacatcgtatcatgttgcagatggctccagattatgacaatctcaccctg
atgcaaaaggttgaagtattcggatacgccatggacaacaccaccgggaaagacctgtat
cgcgtcctgtggctcaagagcaagagctccgaagcctggcttgagcggcgaacgaactac
acacgatcgctgggtgtcatgtccatggtcggctacatcctaggtctgggtgatcgtcat
ccatcaaatcttctcctggaacgcgctaccggacgagtggttcacatcgattttggtgac
tgcttcgaagttgcgatgcaccgtgagaagtatccggagagagtgccattccgcttaact
cggatgttgacattcgctatggaagtcagcaatatcgagggaagctaccgtattacctgc
gaggctgtcatgcgtgtcatcagagacaacaaggattcactaatggctgttctggaagcg
ttcatccacgatcccttgattaattggcgtctgaacatccgagagtcaccagaacggccg
ccattcagcacggagcgccgacagtcagtcacatccgtcatcaatcttgaacatggtgtg
caaccgagtaatttctcccgacaccgtcgtccatcgattctcgacggtggcattctcgat
gtgcaggagggtatcccacctgaagcacgcgaagcacagaatgcacgagcggtgcaggtg
ctggctcgggtgaaggagaagctcacaggtagagatttcaagcccagcgaagagctcaat
gtgagtgatcaggtggacaaacttctcgcgcaggcaacaagcgtcgagaacatatgccag
cactggattggatggtgcagcttctggtag

DBGET integrated database retrieval system