KEGG   Aspergillus clavatus: ACLA_069530Help
Entry
ACLA_069530       CDS       T01148                                 

Definition
urate oxydase UaZ
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
act  Aspergillus clavatus
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ACLA_069530
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    ACLA_069530
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     ACLA_069530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 300 aa AA seqDB search
MPVTAARYGKDNVRVYKVHRDEKTGVQTVVEMTVCVLLEGEIETSYTKADNSVIVATDSI
KNTIYITAKQNPVTPPELFGSILGSHFIQKYKHIHAAHVNIVTHRWSRMNIDGKPHPHSF
VRDSEETRNVQVDVARTTGIDIRSSISKLTVLKSTGSQFWGFLRDEYTTLKETWDRILST
DVDATWQWKRFSGLDEVRANIPKFDAAWVAARDITLKTFAEDNSASVQATMYKMSEQILA
VEPLIETVEYSLPNKHYFEVDLSWHKGLKNTGKDAEVFAPQTNPNGLIKCTVGRTSKPRL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcactgctgctcgctacggaaaggacaatgtccgcgtctacaaggtccaccgt
gatgaaaagaccggtgtccagacggtggtggagatgaccgtctgcgtgctgctggagggc
gagatcgagacatcctacaccaaggccgacaacagcgtcattgtcgcgaccgactcgatc
aagaacaccatctacatcaccgccaagcagaaccccgtcactccccccgagctgttcggc
tccatcctgggctctcacttcatccagaaatataagcacatccacgccgcgcacgtcaac
atcgtcacccaccgctggtcgcgcatgaacatcgacggcaagccccacccgcactccttt
gtccgcgacagcgaggagacccgcaacgttcaggtggatgtggcccgcaccaccggcatc
gacatccggtcctccatctccaagctcaccgtgctcaagagcaccggctcgcagttctgg
ggtttcctccgcgacgagtacaccaccctcaaggagacctgggaccgtatcctgagcacc
gatgtcgacgccacctggcagtggaagcgcttcagcggcctcgacgaggtccgcgccaac
atccccaagttcgacgccgcttgggttgcggcccgcgatatcaccctcaagaccttcgct
gaggacaacagcgccagtgtgcaggcgaccatgtacaagatgtccgagcagatcctggcc
gtcgagcctctgatcgagaccgtcgagtactcgctgcccaacaagcactatttcgaagtt
gacctgagctggcacaagggcctcaagaacaccggcaaggatgccgaggtgttcgccccc
cagacaaaccccaacggcttgatcaagtgcactgttggccgcacatccaagcccagactg
tga

DBGET integrated database retrieval system