KEGG   Aspergillus clavatus: ACLA_069910Help
Entry
ACLA_069910       CDS       T01148                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase family protein
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
act  Aspergillus clavatus
Pathway
act00062  Fatty acid elongation
act00071  Fatty acid degradation
act00280  Valine, leucine and isoleucine degradation
act00310  Lysine degradation
act00380  Tryptophan metabolism
act00410  beta-Alanine metabolism
act00640  Propanoate metabolism
act00650  Butanoate metabolism
act01100  Metabolic pathways
act01110  Biosynthesis of secondary metabolites
act01130  Biosynthesis of antibiotics
act01200  Carbon metabolism
act01212  Fatty acid metabolism
Module
act_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ACLA_069910
   00650 Butanoate metabolism
    ACLA_069910
  Lipid metabolism
   00062 Fatty acid elongation
    ACLA_069910
   00071 Fatty acid degradation
    ACLA_069910
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACLA_069910
   00310 Lysine degradation
    ACLA_069910
   00380 Tryptophan metabolism
    ACLA_069910
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACLA_069910
Enzymes [BR:act01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ACLA_069910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 4707624
NCBI-ProteinID: XP_001275386
UniProt: A1C6D9
AA seq 294 aa AA seqDB search
MVSRQCSRLVSSRTAVPLTSYLTRVGRPYSSAAPAYEHILTSTPKPGVGLITLNRPKALN
ALSSPLFKEINDALSKYEDDKEIGAIVITGSEKAFAAGADIKEMAPLTFSAAYTNNFIAP
WSHLANSIRKPVIAAVSGYALGGGCELALMCDIIYCTTGATFGQPEIKLGTIPGAGGSQR
LTRAVGKSKAMELILTGKNFSGAQAEQWGVAARAVEGGHAELMAEALATAETIAGYSRVA
VVAAKEVVGKSQELSLKEGVEYERRLFHALFGSRDQKIGMTAFAEKKKPEWSNE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggtctctcggcagtgttcccgcctggtgtcctctaggaccgcggttcctctcacatcc
tatcttacccgtgtcggcaggccatactcctccgctgctccggcgtacgagcacattctc
acgtcgactcccaagcctggtgttggactgatcacactcaaccgccccaaggccctcaac
gccctctccagccctcttttcaaagagatcaacgacgctctctccaaatacgaagatgac
aaggaaatcggcgcaatcgtcatcacaggcagcgagaaggcctttgcggccggcgccgac
atcaaagaaatggcacccctaaccttctcggccgcgtacaccaacaacttcatcgcgccg
tggtcgcacctcgccaactccatccgcaagcccgtcatcgccgcggtctcgggctacgcg
ctcggcggcggctgcgagctcgcgctcatgtgcgatatcatctactgcacgacgggcgcg
accttcgggcagcccgagatcaagctgggcacgattcccggcgcgggcggctcgcagcgg
ctgacgcgcgcggtcggcaagagcaaggcgatggagctgattctgacgggcaagaacttc
agcggcgcgcaggcggagcagtggggggttgcggcgcgggcggtcgagggcggccacgcg
gagctgatggcggaggcgctggcgacggccgagacgatcgccgggtatagtcgtgtggcg
gtggtggcggccaaggaggtggtgggaaagagccaggagctgtcgctgaaggagggggtg
gagtatgagcggcggttgttccatgcgttgttcgggagtcgcgatcagaagattggcatg
acggcgttcgcggagaagaagaagcccgagtggtcgaatgagtag

DBGET integrated database retrieval system