KEGG   Aspergillus clavatus: ACLA_069990Help
Entry
ACLA_069990       CDS       T01148                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
act  Aspergillus clavatus
Pathway
act00010  Glycolysis / Gluconeogenesis
act00051  Fructose and mannose metabolism
act00562  Inositol phosphate metabolism
act01100  Metabolic pathways
act01110  Biosynthesis of secondary metabolites
act01130  Biosynthesis of antibiotics
act01200  Carbon metabolism
act01230  Biosynthesis of amino acids
Module
act_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
act_M00002  Glycolysis, core module involving three-carbon compounds
act_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACLA_069990
   00051 Fructose and mannose metabolism
    ACLA_069990
   00562 Inositol phosphate metabolism
    ACLA_069990
Enzymes [BR:act01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ACLA_069990
Exosome [BR:act04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ACLA_069990
  Exosomal proteins of bladder cancer cells
   ACLA_069990
  Exosomal proteins of melanoma cells
   ACLA_069990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 4707519
NCBI-ProteinID: XP_001275394
UniProt: A1C6E7
AA seq 290 aa AA seqDB search
MATQTTVPTFPTLPQNLLIISLKMYFTPDRTLNYLRALLDPQNALLRPESRSKLLLALIP
DFLTIYPCAQILKEHSTASSSNSNSPSTSPALLLGAQDCFWESSGAYTGEVSPQSLRAVG
ASIVELGHAERRAIFGETEAQTAQKAAAACASGLVPLVCVGEVTAPGPVASAAVGRAVSE
CEAQIRPVIEAIPAEAPVIFAYEPVWAIGKPQPAGVEHVAAVVEGIRAVIGSRAGQVRVL
YGGSAGPGLWGPGGLGKAVDGMFLGRFAHEIEGVKKVVREVEKTLEVSQF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaaaccacagtgccgaccttcccaaccctcccccagaacctcctcattatc
tccctaaagatgtacttcacccccgaccgcaccttaaactacctgcgcgccctgctcgac
ccacagaacgccctcctccgcccagagtcccgctccaagctcctcctcgccctcatccca
gacttcctgaccatctacccctgcgcccagatcctgaaggagcactccaccgccagctcc
agcaacagcaacagccccagcacctcccccgccctcctccttggcgcccaggactgcttc
tgggaatcctcaggcgcctacaccggcgaagtctccccgcagtcgctgcgtgccgtcggc
gcctccatcgtcgagctcggccacgccgaacgccgcgccatcttcggcgagactgaagcc
cagaccgcgcagaaggccgccgccgcctgcgctagcggcctcgtgccgctcgtctgcgtc
ggcgaggtcaccgccccaggccccgtggcctcggcggctgtcggccgcgccgtgagcgag
tgcgaggcgcagatccgacccgtgatcgaggcgatccctgccgaggcgcccgtgatcttt
gcgtatgagccggtctgggcgattggcaagccgcagccggcgggcgtggagcatgttgcg
gctgtcgtggaggggatccgcgccgtcattgggagtcgggctgggcaggtgcgggtgctg
tatggggggagcgcggggccggggctgtgggggcccggcgggctggggaaggccgtggat
ggcatgtttctggggaggtttgcgcatgagatcgagggggtgaagaaggtggtgagggag
gtcgaaaagactttggaggtttctcaattttaa

DBGET integrated database retrieval system