KEGG   Aspergillus clavatus: ACLA_070830Help
Entry
ACLA_070830       CDS       T01148                                 

Definition
pyruvate dehydrogenase kinase
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
act  Aspergillus clavatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 433 aa AA seqDB search
MWKPSERLMDTIRHYASFPATGVSLRQMVQFGDRPSTGTLFRASQFLSEELPIRLAHRVQ
DLGELPDGLSEMPSIKKVQDWYAQSFEEIINLPRPTLTQEVKARLLRPGRMHGVSKILSE
ATQNPSIKEGQYRSSPTNGNGNAKGAATRRYFVPSDDHGHWPPELNDYNQRFAKTLQHIK
RRHDSVVTTVAQGILEWKRKRQRLQIDSTVQSFLDRFYMSRIGIRMLIGQHIALTEQTHV
RHPNYVGIICTKTNVREVALEAIDNARFVCEDYYGLFEAPQIQLICKDDLNFMYVPGHLS
HMLFETLKNSLRAVVETHGADKEAFPVTKVIVAEGKEDITIKVSDEGGGIPRSSIPLVWT
YMYTTVDQTPNLDPDFDKNDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGYGTDVYL
HLNRLSSSLEPLQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaccgtcggagaggctgatggacaccatcaggcactatgcgagcttccccgct
actggtgtctctctccgacagatggtgcagttcggagacagaccatcgaccgggaccctc
tttcgtgcctcacaattcctctctgaagagttgccgattcgcttagcgcatcgcgtgcag
gatcttggagaacttcccgatggattgagtgaaatgccgtcgattaagaaggtgcaagat
tggtacgctcagtcgttcgaggaaatcatcaacctaccccgaccgactctgacccaagaa
gtcaaagctcgcttgctacgtcctgggagaatgcacggtgtctccaagatcctctccgaa
gccacccagaatcccagtatcaaggaaggacaatatcggtcgtcccccaccaacggaaat
ggaaatgcaaaaggagctgccacccgaagatacttcgtcccctcggatgaccatggtcac
tggccaccggaattgaatgattataaccaacgattcgcgaaaactctacaacacatcaag
cgccggcacgatagtgtcgtgactactgtcgcccaaggtatcctggaatggaagcggaaa
cgccaacgtctacaaattgattccactgtccagtcgttcctcgatcgcttctatatgtcc
cgtatcggtattcgaatgttaatcggccaacacatcgcattgacagaacaaacgcatgtc
cgccatccgaattatgttggtatcatctgtactaaaacgaacgttcgagaagtggctctc
gaggccattgataacgctcgttttgtctgtgaagattactatggtttattcgaagctcct
cagattcaattgatctgcaaagatgacctgaactttatgtacgtccctggccacttgtcg
cacatgcttttcgagaccctcaagaactcgctgcgtgctgttgtggaaacccatggcgcg
gacaaggaagcttttcccgttaccaaggtcatcgtggccgagggcaaagaggacatcacg
atcaaggtctctgatgaaggcggcggtattccccgttcatctatcccactagtctggacc
tacatgtacaccactgtggatcagactcccaacttggacccggacttcgataagaacgat
ttcaaggctccgatggctggcttcggctatggtctgccaatcagtcgtctgtacgctcga
tactttggcggcgacctcaagctgatcagcatggaaggatatggaacagatgtctatctc
cacctgaatcggctttcctcgagcttggagcccctgcaatga

DBGET integrated database retrieval system