KEGG   Aspergillus clavatus: ACLA_070830Help
Entry
ACLA_070830       CDS       T01148                                 

Definition
(RefSeq) pyruvate dehydrogenase kinase
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
act  Aspergillus clavatus
Brite
Enzymes [BR:act01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     ACLA_070830
Protein kinases [BR:act01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   ACLA_070830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c Crust_neurohorm HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 4707441
NCBI-ProteinID: XP_001275476
UniProt: A1C6M9
AA seq 433 aa AA seqDB search
MWKPSERLMDTIRHYASFPATGVSLRQMVQFGDRPSTGTLFRASQFLSEELPIRLAHRVQ
DLGELPDGLSEMPSIKKVQDWYAQSFEEIINLPRPTLTQEVKARLLRPGRMHGVSKILSE
ATQNPSIKEGQYRSSPTNGNGNAKGAATRRYFVPSDDHGHWPPELNDYNQRFAKTLQHIK
RRHDSVVTTVAQGILEWKRKRQRLQIDSTVQSFLDRFYMSRIGIRMLIGQHIALTEQTHV
RHPNYVGIICTKTNVREVALEAIDNARFVCEDYYGLFEAPQIQLICKDDLNFMYVPGHLS
HMLFETLKNSLRAVVETHGADKEAFPVTKVIVAEGKEDITIKVSDEGGGIPRSSIPLVWT
YMYTTVDQTPNLDPDFDKNDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGYGTDVYL
HLNRLSSSLEPLQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaccgtcggagaggctgatggacaccatcaggcactatgcgagcttccccgct
actggtgtctctctccgacagatggtgcagttcggagacagaccatcgaccgggaccctc
tttcgtgcctcacaattcctctctgaagagttgccgattcgcttagcgcatcgcgtgcag
gatcttggagaacttcccgatggattgagtgaaatgccgtcgattaagaaggtgcaagat
tggtacgctcagtcgttcgaggaaatcatcaacctaccccgaccgactctgacccaagaa
gtcaaagctcgcttgctacgtcctgggagaatgcacggtgtctccaagatcctctccgaa
gccacccagaatcccagtatcaaggaaggacaatatcggtcgtcccccaccaacggaaat
ggaaatgcaaaaggagctgccacccgaagatacttcgtcccctcggatgaccatggtcac
tggccaccggaattgaatgattataaccaacgattcgcgaaaactctacaacacatcaag
cgccggcacgatagtgtcgtgactactgtcgcccaaggtatcctggaatggaagcggaaa
cgccaacgtctacaaattgattccactgtccagtcgttcctcgatcgcttctatatgtcc
cgtatcggtattcgaatgttaatcggccaacacatcgcattgacagaacaaacgcatgtc
cgccatccgaattatgttggtatcatctgtactaaaacgaacgttcgagaagtggctctc
gaggccattgataacgctcgttttgtctgtgaagattactatggtttattcgaagctcct
cagattcaattgatctgcaaagatgacctgaactttatgtacgtccctggccacttgtcg
cacatgcttttcgagaccctcaagaactcgctgcgtgctgttgtggaaacccatggcgcg
gacaaggaagcttttcccgttaccaaggtcatcgtggccgagggcaaagaggacatcacg
atcaaggtctctgatgaaggcggcggtattccccgttcatctatcccactagtctggacc
tacatgtacaccactgtggatcagactcccaacttggacccggacttcgataagaacgat
ttcaaggctccgatggctggcttcggctatggtctgccaatcagtcgtctgtacgctcga
tactttggcggcgacctcaagctgatcagcatggaaggatatggaacagatgtctatctc
cacctgaatcggctttcctcgagcttggagcccctgcaatga

DBGET integrated database retrieval system