KEGG   Aspergillus clavatus: ACLA_071080Help
Entry
ACLA_071080       CDS       T01148                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit PkaC1
Organism
act  Aspergillus clavatus
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 409 aa AA seqDB search
MQSAVTQPHHSSTHHSAGLHHLQQQHQQSQQQQQQQQQQQQQSHHQHSQHTNAASIQNII
HPSQHASSQGSAEGQAAAQQATRAESRTTKGKYSLEDFAIQRTLGTGSFGRVHLVQSKHN
HRFYAIKVLKKAQVVKMKQVEHTNDERRMLNRVRHPFLITLWGTWQDSKNLYMVMDFVEG
GELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSQQIIYRDLKPENLLLDRHGHLKITDF
GFAKEVPDITWTLCGTPDYLAPEVVSSKGYNKSVDWWSLGILIFEMLCGFTPFWDSGSPV
KIYENILRGRVKYPPYLHPDAVDLLSQLITADLTKRLGNLHGGSEDVKNHPWFAEVTWDR
LARKDIDAPYVPPIRGGQGDASQYDRYPEETEQYGQEGEDQHGHMFPDF
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccgccgtgacgcaaccccatcactcctccacccaccacagtgcgggcctccac
catctgcaacagcagcaccagcagtcgcagcagcaacaacaacaacagcagcaacaacag
caacaatcacatcaccagcattcgcagcacaccaatgccgccagtatacagaatataatc
catccttcacagcatgcgtcttcacagggttctgccgaaggccaggccgccgctcagcag
gccacccgggcggagtcccgcaccaccaaagggaaatactccctggaagatttcgccatc
cagcgtacactaggtacgggcagttttggtcgcgtgcacctggtgcaatcaaaacataac
caccggttttatgcgatcaaggtgttgaagaaggcgcaggtggtcaagatgaagcaggtc
gagcacacaaacgatgagcggcggatgctcaatcgcgtccggcatccgttcttgatcacc
ttgtggggtacctggcaggactccaagaatctctacatggtgatggactttgtggagggg
ggtgaattgttcagtctgctgcgcaaatcccagcggttccccaacccggtcgccaaattc
tatgccgccgaagtcactctggcgttggagtacctccactcccagcaaattatctatcgc
gatctgaaaccggagaatctgctcctcgaccgacatggccacctgaagatcaccgacttt
ggctttgcgaaggaggtgcccgacattacctggactctgtgcggaacgcctgattatctc
gccccggaagtggtgtcgtctaaaggatataataaatcagtcgattggtggtcactgggt
atcttgattttcgagatgctgtgcggtttcacgcccttttgggatagtggctcgccggtc
aagatctacgagaacattctccgaggtcgcgtcaaatatccgccataccttcatccagat
gccgtggaccttctctcgcagctgatcaccgcagacctgaccaagcgactgggtaatctg
catggtggatccgaggatgtcaagaaccatccttggttcgctgaggtgacctgggatcgt
ctggcaagaaaggacatcgatgccccctatgtgccccccattcgcggtggccagggtgat
gccagccagtacgatcgctatcccgaggaaaccgaacaatacggccaggagggtgaagac
caacacggtcatatgttccccgacttttaa

DBGET integrated database retrieval system