KEGG   Aspergillus clavatus: ACLA_071930Help
Entry
ACLA_071930       CDS       T01148                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
act  Aspergillus clavatus
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ACLA_071930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 158 aa AA seqDB search
MREAELEAAERAKQIADPMVIIGDAKKGAKLFQTRCAQCHTVEAGGPHKVGPNLSGLFGR
KTGSAEGYAYTDANKQAGVTWDENTLFSYLENPKKFIPGTKMAFGGLKKTKERNDLITSL
ALKHVRIKTSLISDPAAWVLDARSAVKADARQCYGQGM
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaagccgaactagaagcggcggaaagggccaaacagatcgctgacccaatggta
attataggtgacgctaagaagggtgccaagctcttccagactcgctgcgctcagtgccac
actgtcgaggccggtggtccccacaaggtcggccccaatctcagcggtctcttcggccgt
aagaccggttccgccgagggctacgcctacaccgatgccaacaagcaggccggtgtcact
tgggacgagaacactctgttctcctacctcgagaaccccaagaagttcatccccggtacc
aagatggccttcggtggcctgaagaagaccaaggagagaaacgatctgatcacgagtctt
gcgcttaaacatgttcgcattaaaacatcacttatctctgatcctgccgcgtgggtcctg
gatgcgcgttctgcggtaaaagcagacgctcggcagtgctacggacagggcatgtaa

DBGET integrated database retrieval system