KEGG   Aspergillus clavatus: ACLA_072050Help
Entry
ACLA_072050       CDS       T01148                                 

Definition
(RefSeq) bifunctional tryptophan synthase TRPB
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
act  Aspergillus clavatus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACLA_072050
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACLA_072050
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACLA_072050
Enzymes [BR:act01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ACLA_072050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 722 aa AA seqDB search
MEDIKSTFAKCKEQKRAALVAYITAGYPTVEETVDILLGLENGGADIIELGIPFTDPIAD
GPTIQKANTKALANGVTVTIVLQMVRTARSRGLKAPLLLMGYYNPLLRYGEERMLKDCKE
AGVNGFIMVDLPPEEAVRFRDLCASNGLSYVPLIAPATSESRMKLLCKIADSFIYVVSRM
GVTGATGKLSSNLPELLKRVHQWSGNVPAALGFGVSTREHFLDVQELAEGVVIGSQIITT
LAQAPAGQAAKQAEEYLSSVTGRRRERDAQGALTHEINVLEAVEKVQTPAVSQPTDVITD
ADTPAGPGLADQIEALNGAGNPAAQPSRFGEFGGQYVPESLMDCLAELERGFQQALNDPK
FWEEFRSYYPYMGRPSSMHLANRLTEHVGGANIWLKREDLNHTGSHKINNALGQILIARR
LGKTRIIAETGAGQHGVATATVCAKFGMKCVVYMGAEDVRRQALNVFRMKLLGASVVAVD
AGSRTLRDAVNEALRAWVVDLDTTHYIIGSAIGPHPFPTIVRTFQSVIGEETKQQMKEAI
GKLPDAVVACVGGGSNAVGMFYPFAKDTSVKLVGVEAGGDGIDTNRHSATLSGGSKGVLH
GVRTYVLQDEHGQISDTHSISAGLDYPGVGPELSSWKDSDRAHFIAATDAQALIGFRTLA
QTEGIIPALESSHAVWGAMELAKSMKTGDIVLNLSGRGDKDVQSVADELPRLGPQIGWDL
RF
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggaggacatcaagagcactttcgccaagtgcaaggaacagaagcgcgctgcgctcgtt
gcatacatcacagccggttatcctacagtcgaggagaccgtcgatattctcctgggtctc
gagaatggaggcgccgatattatcgaattaggcattcccttcacagaccccattgccgat
gggcctaccatccagaaggccaacaccaaggctctcgccaatggcgtcaccgtcaccatc
gtgctgcagatggtccgcacggccagaagccgaggcttgaaggctcctctcctgttgatg
ggatactacaaccctcttctgcggtacggtgaagagcgcatgctcaaggattgcaaggaa
gccggtgtcaatggtttcatcatggtggatcttcctccggaagaggcggtgcggttccga
gatctgtgcgccagcaatggtctgtcctacgtccccctcatcgctcctgccacctccgag
tcccgcatgaagctcctctgcaagatcgccgattccttcatctacgtcgtctcccgaatg
ggtgtcaccggtgccacagggaagctcagctcgaatctgcccgagctgctgaagcgcgtg
caccagtggtccggcaatgtccccgctgccctcggctttggcgtcagcacccgcgagcac
ttcttggatgtgcaggaactcgccgaaggtgtcgtcattggaagtcagatcatcactact
ttggcgcaggcccctgccggtcaggcggctaagcaggccgaggagtacttgtccagcgtc
accggccgcaggcgcgagagagacgctcagggcgcattgacccacgagatcaatgtgctg
gaggcggtggagaaggtccagacccctgctgtctcgcagcccactgatgtgatcaccgat
gccgacacccctgccggccctggcctggctgatcagattgaggctctcaacggcgccggt
aaccccgccgcgcagccgtcgcgcttcggcgagtttggtggccagtacgtccccgagtct
ctcatggactgcttggcggaactggagcggggattccagcaggcgttgaatgaccccaag
ttctgggaggagttccgctcgtactacccctacatgggccgacccagcagcatgcacctg
gccaaccgtcttaccgagcacgtcggaggcgccaacatctggctcaagcgtgaggatctc
aaccacaccggcagtcacaagatcaacaacgccctcggccagatcctgattgcccggcga
ctgggcaagacccgcatcatcgccgagaccggtgccggacagcacggtgtcgccacggcg
actgtctgcgccaagttcggcatgaagtgtgtcgtatacatgggcgctgaggatgtccgc
cgccaggccctgaatgtcttccggatgaagctgcttggcgcctccgttgtggccgtcgat
gctggcagccggaccctgcgtgatgccgtcaacgaggccctgcgtgcctgggttgttgac
ctcgacaccacccactacatcatcggctccgcgatcggcccccaccccttccccaccatc
gtccgtaccttccagtcggtgatcggtgaggagaccaagcagcagatgaaggaggccatc
ggcaagctgcccgacgccgtcgtcgcctgcgttggtggcggtagcaacgccgtcggcatg
ttctacccattcgccaaggacaccagcgtcaagctggtcggcgtggaagccggcggcgac
ggcatcgacaccaaccgacactcggccaccctctccggcggcagcaagggtgtgttgcac
ggtgtccgcacctacgtcctgcaggacgagcacggccagatctccgatacccactccatc
tccgccggcctggactaccccggcgtcggccccgagctcagctcctggaaggacagcgac
cgtgcccacttcattgccgccaccgacgcccaggccctgatcggcttccgcaccctggcc
cagacggagggcatcatccccgccctggaatcgtcccacgccgtctggggcgccatggag
ctggccaagtccatgaagaccggcgacatcgtcctcaacctcagcggcagaggagacaag
gacgtccagagcgtcgccgacgagctcccccgtctgggtccccagatcggctgggacctg
cgcttctaa

DBGET integrated database retrieval system