KEGG   Aspergillus clavatus: ACLA_072050Help
Entry
ACLA_072050       CDS       T01148                                 

Definition
bifunctional tryptophan synthase TRPB
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
act  Aspergillus clavatus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:act00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACLA_072050
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACLA_072050
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACLA_072050
Enzymes [BR:act01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ACLA_072050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 722 aa AA seqDB search
MEDIKSTFAKCKEQKRAALVAYITAGYPTVEETVDILLGLENGGADIIELGIPFTDPIAD
GPTIQKANTKALANGVTVTIVLQMVRTARSRGLKAPLLLMGYYNPLLRYGEERMLKDCKE
AGVNGFIMVDLPPEEAVRFRDLCASNGLSYVPLIAPATSESRMKLLCKIADSFIYVVSRM
GVTGATGKLSSNLPELLKRVHQWSGNVPAALGFGVSTREHFLDVQELAEGVVIGSQIITT
LAQAPAGQAAKQAEEYLSSVTGRRRERDAQGALTHEINVLEAVEKVQTPAVSQPTDVITD
ADTPAGPGLADQIEALNGAGNPAAQPSRFGEFGGQYVPESLMDCLAELERGFQQALNDPK
FWEEFRSYYPYMGRPSSMHLANRLTEHVGGANIWLKREDLNHTGSHKINNALGQILIARR
LGKTRIIAETGAGQHGVATATVCAKFGMKCVVYMGAEDVRRQALNVFRMKLLGASVVAVD
AGSRTLRDAVNEALRAWVVDLDTTHYIIGSAIGPHPFPTIVRTFQSVIGEETKQQMKEAI
GKLPDAVVACVGGGSNAVGMFYPFAKDTSVKLVGVEAGGDGIDTNRHSATLSGGSKGVLH
GVRTYVLQDEHGQISDTHSISAGLDYPGVGPELSSWKDSDRAHFIAATDAQALIGFRTLA
QTEGIIPALESSHAVWGAMELAKSMKTGDIVLNLSGRGDKDVQSVADELPRLGPQIGWDL
RF
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggaggacatcaagagcactttcgccaagtgcaaggaacagaagcgcgctgcgctcgtt
gcatacatcacagccggttatcctacagtcgaggagaccgtcgatattctcctgggtctc
gagaatggaggcgccgatattatcgaattaggcattcccttcacagaccccattgccgat
gggcctaccatccagaaggccaacaccaaggctctcgccaatggcgtcaccgtcaccatc
gtgctgcagatggtccgcacggccagaagccgaggcttgaaggctcctctcctgttgatg
ggatactacaaccctcttctgcggtacggtgaagagcgcatgctcaaggattgcaaggaa
gccggtgtcaatggtttcatcatggtggatcttcctccggaagaggcggtgcggttccga
gatctgtgcgccagcaatggtctgtcctacgtccccctcatcgctcctgccacctccgag
tcccgcatgaagctcctctgcaagatcgccgattccttcatctacgtcgtctcccgaatg
ggtgtcaccggtgccacagggaagctcagctcgaatctgcccgagctgctgaagcgcgtg
caccagtggtccggcaatgtccccgctgccctcggctttggcgtcagcacccgcgagcac
ttcttggatgtgcaggaactcgccgaaggtgtcgtcattggaagtcagatcatcactact
ttggcgcaggcccctgccggtcaggcggctaagcaggccgaggagtacttgtccagcgtc
accggccgcaggcgcgagagagacgctcagggcgcattgacccacgagatcaatgtgctg
gaggcggtggagaaggtccagacccctgctgtctcgcagcccactgatgtgatcaccgat
gccgacacccctgccggccctggcctggctgatcagattgaggctctcaacggcgccggt
aaccccgccgcgcagccgtcgcgcttcggcgagtttggtggccagtacgtccccgagtct
ctcatggactgcttggcggaactggagcggggattccagcaggcgttgaatgaccccaag
ttctgggaggagttccgctcgtactacccctacatgggccgacccagcagcatgcacctg
gccaaccgtcttaccgagcacgtcggaggcgccaacatctggctcaagcgtgaggatctc
aaccacaccggcagtcacaagatcaacaacgccctcggccagatcctgattgcccggcga
ctgggcaagacccgcatcatcgccgagaccggtgccggacagcacggtgtcgccacggcg
actgtctgcgccaagttcggcatgaagtgtgtcgtatacatgggcgctgaggatgtccgc
cgccaggccctgaatgtcttccggatgaagctgcttggcgcctccgttgtggccgtcgat
gctggcagccggaccctgcgtgatgccgtcaacgaggccctgcgtgcctgggttgttgac
ctcgacaccacccactacatcatcggctccgcgatcggcccccaccccttccccaccatc
gtccgtaccttccagtcggtgatcggtgaggagaccaagcagcagatgaaggaggccatc
ggcaagctgcccgacgccgtcgtcgcctgcgttggtggcggtagcaacgccgtcggcatg
ttctacccattcgccaaggacaccagcgtcaagctggtcggcgtggaagccggcggcgac
ggcatcgacaccaaccgacactcggccaccctctccggcggcagcaagggtgtgttgcac
ggtgtccgcacctacgtcctgcaggacgagcacggccagatctccgatacccactccatc
tccgccggcctggactaccccggcgtcggccccgagctcagctcctggaaggacagcgac
cgtgcccacttcattgccgccaccgacgcccaggccctgatcggcttccgcaccctggcc
cagacggagggcatcatccccgccctggaatcgtcccacgccgtctggggcgccatggag
ctggccaagtccatgaagaccggcgacatcgtcctcaacctcagcggcagaggagacaag
gacgtccagagcgtcgccgacgagctcccccgtctgggtccccagatcggctgggacctg
cgcttctaa

DBGET integrated database retrieval system